Clone LD39576 Report

Search the DGRC for LD39576

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:395
Well:76
Vector:pOT2
Associated Gene/TranscriptCG1896-RA
Protein status:LD39576.pep: gold
Preliminary Size:970
Sequenced Size:823

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1896 2001-01-01 Release 2 assignment
CG1896 2001-10-10 Blastp of sequenced clone
CG1896 2003-01-01 Sim4 clustering to Release 3
CG1896 2008-04-29 Release 5.5 accounting
CG1896 2008-08-15 Release 5.9 accounting
CG1896 2008-12-18 5.12 accounting

Clone Sequence Records

LD39576.complete Sequence

823 bp (823 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061454

> LD39576.complete
AGATGACTCCGCCGCACAAAAAGCATAGATTAAGTGAAGTTAAAGCCAAG
ATTCAGCAAGTTATATCGAGTTTGGGGCAACTGGAGCAACAGAGCTGTGG
AGCAGGTCGCGATTTCGATGTGCACCGGGCGGAGGAGCTGCAGCGGAGCA
CGGCAACCCTGCTGGATGAACTTGACCAAGTACCGGGCCAACAAGTAGTC
GACGAACAAAAACAAAGAAAACGCCGGCGACGCTTATATAGACGAAGCCA
ACATCGGGTGATACGTGCAACCGTCAAATCTGAGGCTGCAGAACAGAAGT
TCTCCATAGAACCGCCCCGAAATACCGCACTGGAACAAGCGAAGCACATA
TCCCTGCGAAAACAACGCGATGCTGCCTCCATTTTGGAGACCTTTGATCT
TCTGGAGAAACTTTGCGAGTCTCGTGGAGGAGACAGAGCCGCCCTTTGCC
AAAAACTGACCCACATGCGTCTTGTTTGGCGCAGAGTCCAAGAAGAGACT
CAAGCTGGCCATGTCAAGGAGTCCAAGAAGGTGGCTTCACTTGAATCTCA
ATGGAAGGCTGTGTTCTTCGGCCGATCCTTGCCAACTCCCAAATTAAATA
AGGGGAAATTTCTTGAAATTCGCTCCACATGGGATTCTTACATAAGCTAC
TGTGGAAGAGGCTCCTCTATACCCAGAGGATGGGTGCTACCGCCAACAAA
GCCTACAGCTCAGTGGATAGGCTATCGACTATCCTTAACTTAATATCATA
GAAACCTTTCCAAAGCTCACACTCCTTATAAAGAAGCAAGATTATATAGT
AAAACAAAAAAAAAAAAAAAAAA

LD39576.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG1896-RA 847 CG1896-RA 46..847 1..802 4010 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 27566668..27567289 1..622 3110 100 Plus
chr3R 27901430 chr3R 27567351..27567531 622..802 905 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:34:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31744317..31744938 1..622 3110 100 Plus
3R 32079331 3R 31745000..31745180 622..802 905 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 31485148..31485769 1..622 3110 100 Plus
3R 31820162 3R 31485831..31486011 622..802 905 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:04:53 has no hits.

LD39576.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:05:36 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 27566668..27567289 1..622 100 -> Plus
chr3R 27567352..27567531 623..805 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:21:51 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
CG1896-RA 1..741 3..743 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:33 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
CG1896-RA 1..741 3..743 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:38:16 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
CG1896-RA 1..741 3..743 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:37 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
CG1896-RA 1..741 3..743 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:30:43 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
CG1896-RA 1..741 3..743 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:35:15 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
CG1896-RA 31..832 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:33 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
CG1896-RA 31..830 1..800 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:38:16 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
CG1896-RA 36..835 1..800 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:19:38 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
CG1896-RA 31..832 1..802 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:30:43 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
CG1896-RA 36..835 1..800 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:36 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31744317..31744938 1..622 100 -> Plus
3R 31745001..31745180 623..805 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:36 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31744317..31744938 1..622 100 -> Plus
3R 31745001..31745180 623..805 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:36 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31744317..31744938 1..622 100 -> Plus
3R 31745001..31745180 623..805 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:38:16 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27570039..27570660 1..622 100 -> Plus
arm_3R 27570723..27570902 623..805 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:56:20 Download gff for LD39576.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31485148..31485769 1..622 100 -> Plus
3R 31485832..31486011 623..805 98   Plus

LD39576.pep Sequence

Translation from 2 to 742

> LD39576.pep
MTPPHKKHRLSEVKAKIQQVISSLGQLEQQSCGAGRDFDVHRAEELQRST
ATLLDELDQVPGQQVVDEQKQRKRRRRLYRRSQHRVIRATVKSEAAEQKF
SIEPPRNTALEQAKHISLRKQRDAASILETFDLLEKLCESRGGDRAALCQ
KLTHMRLVWRRVQEETQAGHVKESKKVASLESQWKAVFFGRSLPTPKLNK
GKFLEIRSTWDSYISYCGRGSSIPRGWVLPPTKPTAQWIGYRLSLT*

LD39576.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23255-PA 271 GF23255-PA 10..246 9..242 548 49.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11829-PA 245 GG11829-PA 1..244 1..244 930 81.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18654-PA 167 GH18654-PA 4..165 71..242 266 38.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG1896-PA 246 CG1896-PA 1..246 1..246 1271 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23131-PA 255 GI23131-PA 6..252 9..241 367 39.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23998-PA 240 GL23998-PA 2..238 4..242 409 41.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15115-PB 240 GA15115-PB 2..238 4..242 401 38.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16449-PA 246 GM16449-PA 1..246 1..246 1140 91.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21601-PA 246 GD21601-PA 1..246 1..246 1161 92.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23105-PA 252 GJ23105-PA 5..250 8..242 365 39.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19211-PA 239 GK19211-PA 3..237 8..241 321 37.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10963-PA 245 GE10963-PA 1..244 1..244 1016 84.8 Plus

LD39576.hyp Sequence

Translation from 2 to 742

> LD39576.hyp
MTPPHKKHRLSEVKAKIQQVISSLGQLEQQSCGAGRDFDVHRAEELQRST
ATLLDELDQVPGQQVVDEQKQRKRRRRLYRRSQHRVIRATVKSEAAEQKF
SIEPPRNTALEQAKHISLRKQRDAASILETFDLLEKLCESRGGDRAALCQ
KLTHMRLVWRRVQEETQAGHVKESKKVASLESQWKAVFFGRSLPTPKLNK
GKFLEIRSTWDSYISYCGRGSSIPRGWVLPPTKPTAQWIGYRLSLT*

LD39576.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG1896-PA 246 CG1896-PA 1..246 1..246 1271 100 Plus