Clone LD39624 Report

Search the DGRC for LD39624

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:396
Well:24
Vector:pOT2
Associated Gene/TranscriptCG3209-RB
Protein status:LD39624.pep: gold
Preliminary Size:1780
Sequenced Size:1644

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3209 2001-01-01 Release 2 assignment
CG3209 2001-07-04 Blastp of sequenced clone
CG3209 2003-01-01 Sim4 clustering to Release 3
CG3209 2008-04-29 Release 5.5 accounting
CG3209 2008-08-15 Release 5.9 accounting
CG3209 2008-12-18 5.12 accounting

Clone Sequence Records

LD39624.complete Sequence

1644 bp (1644 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051906

> LD39624.complete
CCATCGCTAGTTCGGTCTACAGCAAAAAGTATTTTAACATTGTATATATT
GGCACGACACAATTCGGAGGCATTTTTCGCTTAACAATAACTAATGTCGC
ATGACACAAATGTAAAATGATCGCCGTGCTGTTGGACATATTCTGGATCC
CCATCGGGGGCTTCCTCTCATTTCTCATATTTATTTCCGCCATAAACAAA
TCAATCGGCGTCCGAAAAGCGTACGTGAACCTCCTCCTAAGGATATTCGA
GTATGGTCGAGTTAGTATAGAGACAGCATCCAAAGAAAACCAACACATTC
AAAATCCCAAGACTGACGACAAACAGGGAGTGCAACTAGTGGACGACGCC
GATTCCAAAGAAGGCACCAATGGAGCCACATTGATTACCAGGGACGCGGT
ACTCCTGCCCCAGCCACAGGAGCCCGCTCCAGAGAAGCCAGTTTCCTCCA
CAAAGGATGAAATCAATTTCGATTTTGAGAAATGCCTGGACTACGTAAAG
TCTGGCGTGGAGGCCATCATCGAGGACGATGTTACGTCGCGCTTCGAGGC
GGAGGAGCTCAAGAGCTGGAACATGCTGACACGCACCAATAGGCACTACG
AGTTCATTTCCTGGAAAATCACCTCCATCTGGGTGTTCGGCTTCTTCATC
CGCTACGTCATCCTGATGCCCCTCCGGGTATTGGTATGCTTCGTTGGTGT
AGTGTGGTTAACAGTCTGCACGGCTGCAGTGGGATACTTGAAGGATGGGC
CCTTCAAGCGGGATCTCGTGCACAAGGTGCTCGGCATGTGCTTCGGCGTT
TTGTCCAGCGCTATATCGGCGGTTATCACCTACCACAATGAGGATAATCG
CCCGTCATCCGGTATTTGTGTTGCCAATCACACCAGTCCCATTGATGTGC
TGGTCCTGATGTGCGACTCGACCTACTCGCTGATTGGCCAACGCCATGGC
GGCTTTTTGGGGGTGCTGCAACGAGCTCTGGCCCGCGCATCTCCCCACAT
TTGGTTTGAGCGCGGCGAGGCCAAGGATCGTCATTTGGTGGCCGAGCGAC
TGAAGCAGCACGTGTCTGATCCGAACAACCCACCGATCCTTATCTTCCCG
GAGGGAACTTGCATCAACAACACGTCGGTCATGCAGTTCAAGAAGGGCAG
CTTCGAAGTTGGCGGCGTCATCTACCCGGTGGCCATTAAGTACGATCCGA
GGTTCGGCGACGCCTTCTGGAACAGCGCGAAGTACTCGATGATGCAGTAT
CTGTACATGATGATGACCTCGTGGGCCATCGTGTGCGATGTGTGGTACCT
GCCGCCGATGTACAGGCAGGAGGGAGAGTCGGCGATCGACTTCGCGAACC
GCGTGAAGAGTGTCATCGCGAAGCAGGGAGGTTTGATTGATCTGGTCTGG
GACGGGCAGCTGAAGCGCATGAAGCCAAAGAAGGAGTGGAGGGAGATCCA
GCAAGTCGAGTTTGCCAATCGGCTGAAGTCGGACTCCACCTAAATTACCA
TATTACCATACAGTGACTGTAAATGATATACATACATGATTTTGCATAAT
TTGTATTGCAGCGACTGTAATTTGTATAAATTACGATTAACAATTGGATG
GTTAAATAAAAGATGAAGTCAAATGTAAAAAAAAAAAAAAAAAA

LD39624.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG3209.b 2612 CG3209.b 328..1954 1..1627 8135 100 Plus
CG3209.d 2261 CG3209.d 328..1954 1..1627 8135 100 Plus
CG3209.a 2125 CG3209.a 1110..2038 699..1627 4645 100 Plus
CG3209.a 2125 CG3209.a 175..874 1..700 3500 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19959033..19959469 1190..1626 2185 100 Plus
chr2R 21145070 chr2R 19955100..19955350 1..251 1240 99.6 Plus
chr2R 21145070 chr2R 19958709..19958968 932..1191 1240 98.5 Plus
chr2R 21145070 chr2R 19956014..19956260 454..700 1235 100 Plus
chr2R 21145070 chr2R 19957996..19958229 699..932 1155 99.6 Plus
chr2R 21145070 chr2R 19955753..19955959 250..456 1020 99.5 Plus
chrX 22417052 chrX 20690472..20690615 1083..1226 240 77.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:34:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24073028..24073465 1190..1627 2190 100 Plus
2R 25286936 2R 24072704..24072963 932..1191 1300 100 Plus
2R 25286936 2R 24069084..24069334 1..251 1255 100 Plus
2R 25286936 2R 24069998..24070244 454..700 1235 100 Plus
2R 25286936 2R 24071991..24072224 699..932 1170 100 Plus
2R 25286936 2R 24069737..24069943 250..456 1035 100 Plus
X 23542271 X 20825153..20825296 1083..1226 240 77.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24074227..24074664 1190..1627 2190 100 Plus
2R 25260384 2R 24073903..24074162 932..1191 1300 100 Plus
2R 25260384 2R 24070283..24070533 1..251 1255 100 Plus
2R 25260384 2R 24071197..24071443 454..700 1235 100 Plus
2R 25260384 2R 24073190..24073423 699..932 1170 100 Plus
2R 25260384 2R 24070936..24071142 250..456 1035 100 Plus
X 23527363 X 20810245..20810388 1083..1226 240 77.7 Plus
Blast to na_te.dros performed on 2019-03-16 05:39:54 has no hits.

LD39624.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:40:53 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19955100..19955350 1..251 99 -> Plus
chr2R 19955755..19955958 252..455 99 -> Plus
chr2R 19956016..19956258 456..698 100 -> Plus
chr2R 19957996..19958229 699..932 99 -> Plus
chr2R 19958710..19958966 933..1189 98 -> Plus
chr2R 19959033..19959469 1190..1626 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:21:54 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RB 1..1377 117..1493 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:17:10 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RB 1..1377 117..1493 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:12:08 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RB 1..1377 117..1493 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:48:40 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RB 1..1377 117..1493 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:09:01 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RB 1..1377 117..1493 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:11:46 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RB 175..1800 1..1626 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:17:10 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RB 175..1800 1..1626 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:12:08 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RB 35..1660 1..1626 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:48:40 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RB 175..1800 1..1626 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:09:01 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RB 35..1660 1..1626 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:40:53 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24069084..24069334 1..251 100 -> Plus
2R 24069739..24069942 252..455 100 -> Plus
2R 24070000..24070242 456..698 100 -> Plus
2R 24071991..24072224 699..932 100 -> Plus
2R 24072705..24072961 933..1189 100 -> Plus
2R 24073028..24073464 1190..1626 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:40:53 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24069084..24069334 1..251 100 -> Plus
2R 24069739..24069942 252..455 100 -> Plus
2R 24070000..24070242 456..698 100 -> Plus
2R 24071991..24072224 699..932 100 -> Plus
2R 24072705..24072961 933..1189 100 -> Plus
2R 24073028..24073464 1190..1626 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:40:53 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24069084..24069334 1..251 100 -> Plus
2R 24069739..24069942 252..455 100 -> Plus
2R 24070000..24070242 456..698 100 -> Plus
2R 24071991..24072224 699..932 100 -> Plus
2R 24072705..24072961 933..1189 100 -> Plus
2R 24073028..24073464 1190..1626 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:12:08 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19956607..19956857 1..251 100 -> Plus
arm_2R 19957262..19957465 252..455 100 -> Plus
arm_2R 19957523..19957765 456..698 100 -> Plus
arm_2R 19959514..19959747 699..932 100 -> Plus
arm_2R 19960228..19960484 933..1189 100 -> Plus
arm_2R 19960551..19960987 1190..1626 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:26:46 Download gff for LD39624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24074245..24074681 1190..1626 100   Plus
2R 24070301..24070551 1..251 100 -> Plus
2R 24070956..24071159 252..455 100 -> Plus
2R 24071217..24071459 456..698 100 -> Plus
2R 24073208..24073441 699..932 100 -> Plus
2R 24073922..24074178 933..1189 100 -> Plus

LD39624.pep Sequence

Translation from 116 to 1492

> LD39624.pep
MIAVLLDIFWIPIGGFLSFLIFISAINKSIGVRKAYVNLLLRIFEYGRVS
IETASKENQHIQNPKTDDKQGVQLVDDADSKEGTNGATLITRDAVLLPQP
QEPAPEKPVSSTKDEINFDFEKCLDYVKSGVEAIIEDDVTSRFEAEELKS
WNMLTRTNRHYEFISWKITSIWVFGFFIRYVILMPLRVLVCFVGVVWLTV
CTAAVGYLKDGPFKRDLVHKVLGMCFGVLSSAISAVITYHNEDNRPSSGI
CVANHTSPIDVLVLMCDSTYSLIGQRHGGFLGVLQRALARASPHIWFERG
EAKDRHLVAERLKQHVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVGG
VIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMYR
QEGESAIDFANRVKSVIAKQGGLIDLVWDGQLKRMKPKKEWREIQQVEFA
NRLKSDST*

LD39624.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11367-PA 539 GF11367-PA 276..539 195..458 1420 97.3 Plus
Dana\GF11367-PA 539 GF11367-PA 1..276 1..273 1054 74.3 Plus
Dana\GF21703-PA 440 GF21703-PA 108..440 113..442 959 49.8 Plus
Dana\GF22630-PA 558 GF22630-PA 102..351 187..423 205 26 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22933-PA 537 GG22933-PA 274..537 195..458 1447 100 Plus
Dere\GG22933-PA 537 GG22933-PA 1..274 1..273 1139 79.9 Plus
Dere\GG19698-PA 439 GG19698-PA 107..439 113..442 918 47.7 Plus
Dere\GG18969-PA 474 GG18969-PA 64..331 169..423 217 24.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21717-PA 537 GH21717-PA 273..537 192..456 1354 92.8 Plus
Dgri\GH17744-PA 405 GH17744-PA 59..405 99..442 934 49 Plus
Dgri\GH21717-PA 537 GH21717-PA 1..276 1..273 891 62 Plus
Dgri\GH12406-PA 556 GH12406-PA 84..344 171..418 203 24.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Gpat4-PB 458 CG3209-PB 1..458 1..458 2411 100 Plus
Gpat4-PC 459 CG3209-PC 1..459 1..458 2133 89.3 Plus
Gpat4-PD 537 CG3209-PD 274..537 195..458 1410 100 Plus
Gpat4-PD 537 CG3209-PD 1..274 1..273 1138 81.8 Plus
Gpat4-PE 380 CG3209-PE 1..195 1..195 1004 99.5 Plus
Gpat4-PE 380 CG3209-PE 188..380 263..458 999 96.4 Plus
CG15450-PA 407 CG15450-PA 75..407 113..442 909 47.7 Plus
LPCAT-PB 533 CG32699-PB 63..328 171..423 217 25 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18864-PA 538 GI18864-PA 273..538 192..456 1355 93.2 Plus
Dmoj\GI18864-PA 538 GI18864-PA 1..276 1..273 821 63.4 Plus
Dmoj\GI15857-PA 554 GI15857-PA 84..344 171..418 223 25.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11661-PA 531 GL11661-PA 267..531 192..456 1368 94 Plus
Dper\GL11661-PA 531 GL11661-PA 1..270 1..273 948 67.2 Plus
Dper\GL15809-PA 417 GL15809-PA 82..417 109..441 926 47.6 Plus
Dper\GL13112-PA 512 GL13112-PA 75..342 169..423 228 25.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16670-PA 531 GA16670-PA 267..531 192..456 1368 94 Plus
Dpse\GA16670-PA 531 GA16670-PA 1..270 1..273 948 67.2 Plus
Dpse\GA13739-PA 417 GA13739-PA 82..417 109..441 928 48.2 Plus
Dpse\GA23062-PA 512 GA23062-PA 75..342 169..423 229 25.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18300-PA 537 GM18300-PA 274..537 195..458 1446 99.6 Plus
Dsec\GM18300-PA 537 GM18300-PA 1..274 1..273 1139 79.9 Plus
Dsec\GM23052-PA 281 GM23052-PA 161..281 322..442 435 58.7 Plus
Dsec\GM11357-PA 452 GM11357-PA 61..328 169..423 217 25.5 Plus
Dsec\GM23052-PA 281 GM23052-PA 75..158 113..193 168 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11832-PA 537 GD11832-PA 274..537 195..458 1448 100 Plus
Dsim\GD11832-PA 537 GD11832-PA 1..274 1..273 1148 80.7 Plus
Dsim\GD24693-PA 435 GD24693-PA 103..435 113..442 924 47.4 Plus
Dsim\GD16057-PA 361 GD16057-PA 62..237 250..423 201 28.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20434-PA 537 GJ20434-PA 273..537 192..456 1363 93.2 Plus
Dvir\GJ19255-PA 425 GJ19255-PA 92..425 112..442 890 50.6 Plus
Dvir\GJ20434-PA 537 GJ20434-PA 1..276 1..273 819 60.1 Plus
Dvir\GJ19019-PA 439 GJ19019-PA 39..306 169..423 220 24.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21924-PA 536 GK21924-PA 272..536 192..456 1391 94.7 Plus
Dwil\GK21924-PA 536 GK21924-PA 1..275 1..273 948 66.2 Plus
Dwil\GK19819-PA 326 GK19819-PA 1..326 120..442 922 51.5 Plus
Dwil\GK10139-PA 552 GK10139-PA 56..323 169..423 227 25 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14370-PA 537 GE14370-PA 274..537 195..458 1450 100 Plus
Dyak\GE14370-PA 537 GE14370-PA 1..274 1..273 1145 80.3 Plus
Dyak\GE17896-PA 407 GE17896-PA 75..407 113..442 915 46.5 Plus
Dyak\GE15443-PA 455 GE15443-PA 64..331 169..423 218 25.5 Plus

LD39624.hyp Sequence

Translation from 116 to 1492

> LD39624.hyp
MIAVLLDIFWIPIGGFLSFLIFISAINKSIGVRKAYVNLLLRIFEYGRVS
IETASKENQHIQNPKTDDKQGVQLVDDADSKEGTNGATLITRDAVLLPQP
QEPAPEKPVSSTKDEINFDFEKCLDYVKSGVEAIIEDDVTSRFEAEELKS
WNMLTRTNRHYEFISWKITSIWVFGFFIRYVILMPLRVLVCFVGVVWLTV
CTAAVGYLKDGPFKRDLVHKVLGMCFGVLSSAISAVITYHNEDNRPSSGI
CVANHTSPIDVLVLMCDSTYSLIGQRHGGFLGVLQRALARASPHIWFERG
EAKDRHLVAERLKQHVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVGG
VIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMYR
QEGESAIDFANRVKSVIAKQGGLIDLVWDGQLKRMKPKKEWREIQQVEFA
NRLKSDST*

LD39624.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG3209-PB 458 CG3209-PB 1..458 1..458 2411 100 Plus
CG3209-PC 459 CG3209-PC 1..459 1..458 2133 89.3 Plus
CG3209-PD 537 CG3209-PD 274..537 195..458 1410 100 Plus
CG3209-PD 537 CG3209-PD 1..274 1..273 1138 81.8 Plus
CG3209-PE 380 CG3209-PE 1..195 1..195 1004 99.5 Plus
CG3209-PE 380 CG3209-PE 188..380 263..458 999 96.4 Plus
CG15450-PA 407 CG15450-PA 75..407 113..442 909 47.7 Plus