Clone LD39912 Report

Search the DGRC for LD39912

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:399
Well:12
Vector:pOT2
Associated Gene/TranscriptCG3303-RA
Protein status:LD39912.pep: gold
Preliminary Size:1741
Sequenced Size:1598

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3303 2001-07-04 Blastp of sequenced clone
CG3303 2003-01-01 Sim4 clustering to Release 3
CG3303 2008-04-29 Release 5.5 accounting
CG3303 2008-08-15 Release 5.9 accounting
CG3303 2008-12-18 5.12 accounting

Clone Sequence Records

LD39912.complete Sequence

1598 bp (1598 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051910

> LD39912.complete
TCGGAAAGAGCAGATAAAACTCGATCAACGCGAGAGTTTTGGCTGAAGAT
AAACGGCGAGCATCGGGAAAGTAAACAGAGGCGCAAAAACAAATGTTTGA
CTAATCTTAATTGGATAATTATATCACAATGGACGCAGTGCAGCAGCAAA
CAAACAGCACTAGCAACATCGACAGCGCCAAATGCCAGAAGCTAAAGAGA
TTTGTGATCGTAGGCTTGCTGATCACCATTGGCATTTTGAGCTGGCACTT
CTACGAGTACTTCCACAGCAAGCCGCTGCCCAAAACGCCGGATGACGTCT
TGACCCTCTCGAAGAATCTGTACGCGGAGGAGACCGAGGTCAGTCCATAC
CTCTACAAGGTGAATCTCCAGGGGAAGACCACTTCAGGTGCTCATGACGA
TCGCGCCCCTAGAAACCTCTTTGAATTGCACCAGGATCTGCTGGCCAGGG
ATGCTAACTCCACCACCGCTCTGCTAATGAGGCTCTTTGACAACTACGAG
TTGGACGTGGCTGTGCAGGAGCATCCAACGCCGGAGCACGTCCAGGAGCA
ATATGATTTCCTTAGGGCCGTGATGGGTACGCGTGTGATGAAGCTGACCA
TGCGTTTTTTGGTACACAAGGATATTGTGAGCGTAGAATATGACGATCAG
CTGCGTCTGCTGCAGGAGCTGTGGTTCACTCCCTACTCCAGAGGTCGTGG
CATTGTGGGCAGTTCCAGTTTCGAGCACGTCTTCATGGCGGAGATTCGGG
ACCAGAAGGTCCTGGGCTTGCATAACTGGCTGTACTTTGCAGATCAGGAG
CAACGTGGCAATGTGGACTACAAGGGCTGGCTGAACCACAAGGAAATGGG
AAAGCACAACCAAATGGTTCTCAGCGTTCGCTACACGTTTCACAACATCA
ATAAGCCAGTCAACGGCTTCTTTGTGGGCATCTCGCCCGAACTGGACATG
GCCCTGTACACCGCCTGCTTCCTGGCCACGGCGAAGGAGGAACCCTGCCA
CATCCAGTTGGGTCATGCCTCCGCCACGATTGTCTCCCACGAATGGAAAT
GGAACGGTATGCGCCTGATAGGAACCGTCTATCCGGACAGCTCCTAGATC
ACTCCAACCACCCATCTCGCAACCTCAGTCAAATTACTGACATTCGATTC
GGTCGCACTGTTACCTCATCGAAATCAGCAAAAGGCTAACCTCCAAGCTC
AAAGTCAAGTTCATTTTATTTTGCCACTTTATGAGTGCTTGGCCCAGTTG
TCGCTGGCAATTGACGAGGATGTCAGTCAGGACATGAACAATGCCCATCT
GCCTATCATTTTGGTTGTTTTGACAGGATTGCGTGGCGCAGAGCACTTAC
ATCACGAAGTTGTTTATTAGTTCTAACATTAATAGTTATTACTGGCGGAA
ATTATGCAAGAGGCAAAAGCGTTTATTTTGAAGGAGCGAAAGGAGGAAAA
GTGAGTGTGACGTTTTAGTATTATGCAGTCATTAAGCTCACCCTCGAAAT
GGATTCTACCCACTATAATTTTTATACCTTTGAATCTCTTGAACTAGCTA
GTTGAAAATAAAATAACAAAATCAACTTAAAAAAAAAAAAAAAAAAAA

LD39912.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG3303-RA 1609 CG3303-RA 32..1609 1..1578 7890 100 Plus
CG31292-RA 445 CG31292-RA 27..441 1..415 2075 100 Plus
CG2145-RA 2085 CG2145-RA 1800..1851 921..972 155 86.5 Plus
CG2145-RA 2085 CG2145-RA 1546..1615 664..733 140 80 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11734207..11734932 853..1578 3630 100 Plus
chr3R 27901430 chr3R 11733030..11733284 1..255 1275 100 Plus
chr3R 27901430 chr3R 11730852..11731106 1..255 1275 100 Plus
chr3R 27901430 chr3R 11733912..11734145 621..854 1170 100 Plus
chr3R 27901430 chr3R 11733650..11733855 416..621 1030 100 Plus
chr3R 27901430 chr3R 11731165..11731325 255..415 805 100 Plus
chr3R 27901430 chr3R 11733343..11733503 255..415 805 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:34:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15909642..15910368 853..1579 3635 100 Plus
3R 32079331 3R 15906273..15906527 1..255 1275 100 Plus
3R 32079331 3R 15908465..15908719 1..255 1275 100 Plus
3R 32079331 3R 15909347..15909580 621..854 1170 100 Plus
3R 32079331 3R 15909085..15909290 416..621 1030 100 Plus
3R 32079331 3R 15906586..15906746 255..415 805 100 Plus
3R 32079331 3R 15908778..15908938 255..415 805 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15650473..15651199 853..1579 3635 100 Plus
3R 31820162 3R 15649296..15649550 1..255 1275 100 Plus
3R 31820162 3R 15647104..15647358 1..255 1275 100 Plus
3R 31820162 3R 15650178..15650411 621..854 1170 100 Plus
3R 31820162 3R 15649916..15650121 416..621 1030 100 Plus
3R 31820162 3R 15649609..15649769 255..415 805 100 Plus
3R 31820162 3R 15647417..15647577 255..415 805 100 Plus
X 23527363 X 10937553..10937604 921..972 155 86.5 Plus
X 23527363 X 10937174..10937243 664..733 140 80 Plus
Blast to na_te.dros performed on 2019-03-16 10:59:41 has no hits.

LD39912.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:00:53 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11733030..11733284 1..255 100 -> Plus
chr3R 11733344..11733503 256..415 100 -> Plus
chr3R 11733650..11733855 416..621 100 -> Plus
chr3R 11733913..11734145 622..854 100 -> Plus
chr3R 11734209..11734932 855..1578 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:22:09 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
CG3303-RA 1..969 129..1097 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:17:14 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
CG3303-RA 1..969 129..1097 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:42:16 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
CG3303-RA 1..969 129..1097 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:48:43 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
CG3303-RA 1..969 129..1097 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:23:01 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
CG3303-RA 1..969 129..1097 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:11:52 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
CG3303-RA 32..1609 1..1578 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:17:14 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
CG3303-RA 32..1609 1..1578 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:42:16 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
CG3303-RA 32..1609 1..1578 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:48:43 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
CG3303-RA 32..1609 1..1578 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:23:01 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
CG3303-RA 68..1645 1..1578 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:00:53 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15909348..15909580 622..854 100 -> Plus
3R 15908465..15908719 1..255 100 -> Plus
3R 15908779..15908938 256..415 100 -> Plus
3R 15909085..15909290 416..621 100 -> Plus
3R 15909644..15910367 855..1578 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:00:53 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15909348..15909580 622..854 100 -> Plus
3R 15908465..15908719 1..255 100 -> Plus
3R 15908779..15908938 256..415 100 -> Plus
3R 15909085..15909290 416..621 100 -> Plus
3R 15909644..15910367 855..1578 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:00:53 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15909348..15909580 622..854 100 -> Plus
3R 15908465..15908719 1..255 100 -> Plus
3R 15908779..15908938 256..415 100 -> Plus
3R 15909085..15909290 416..621 100 -> Plus
3R 15909644..15910367 855..1578 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:42:16 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11734807..11735012 416..621 100 -> Plus
arm_3R 11735070..11735302 622..854 100 -> Plus
arm_3R 11734187..11734441 1..255 100 -> Plus
arm_3R 11734501..11734660 256..415 100 -> Plus
arm_3R 11735366..11736089 855..1578 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:26:50 Download gff for LD39912.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15649296..15649550 1..255 100 -> Plus
3R 15649610..15649769 256..415 100 -> Plus
3R 15649916..15650121 416..621 100 -> Plus
3R 15650179..15650411 622..854 100 -> Plus
3R 15650475..15651198 855..1578 100   Plus

LD39912.pep Sequence

Translation from 128 to 1096

> LD39912.pep
MDAVQQQTNSTSNIDSAKCQKLKRFVIVGLLITIGILSWHFYEYFHSKPL
PKTPDDVLTLSKNLYAEETEVSPYLYKVNLQGKTTSGAHDDRAPRNLFEL
HQDLLARDANSTTALLMRLFDNYELDVAVQEHPTPEHVQEQYDFLRAVMG
TRVMKLTMRFLVHKDIVSVEYDDQLRLLQELWFTPYSRGRGIVGSSSFEH
VFMAEIRDQKVLGLHNWLYFADQEQRGNVDYKGWLNHKEMGKHNQMVLSV
RYTFHNINKPVNGFFVGISPELDMALYTACFLATAKEEPCHIQLGHASAT
IVSHEWKWNGMRLIGTVYPDSS*

LD39912.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18549-PA 323 GF18549-PA 1..323 1..322 1458 83 Plus
Dana\GF16037-PA 152 GF16037-PA 1..143 44..186 677 88.8 Plus
Dana\GF20477-PA 592 GF20477-PA 331..591 55..320 590 42.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16962-PA 322 GG16962-PA 1..322 1..322 1637 93.2 Plus
Dere\GG18381-PA 592 GG18381-PA 329..591 53..320 589 42.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23462-PA 324 GH23462-PA 1..318 1..318 1181 70.8 Plus
Dgri\GH12680-PA 676 GH12680-PA 415..675 55..320 557 41.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
EndoU-PA 322 CG3303-PA 1..322 1..322 1711 100 Plus
CG2145-PB 592 CG2145-PB 329..591 53..320 561 42.8 Plus
CG2145-PA 592 CG2145-PA 329..591 53..320 561 42.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22951-PA 327 GI22951-PA 18..323 13..318 1121 70.6 Plus
Dmoj\GI16258-PA 637 GI16258-PA 376..636 55..320 557 41.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22078-PA 325 GL22078-PA 1..323 1..321 1431 82.4 Plus
Dper\GL18244-PA 549 GL18244-PA 288..548 55..320 569 41.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27370-PA 325 GA27370-PA 1..323 1..321 1431 82.4 Plus
Dpse\GA15266-PA 615 GA15266-PA 354..614 55..320 569 41.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24268-PA 322 GM24268-PA 1..322 1..322 1714 97.2 Plus
Dsec\GM11444-PA 588 GM11444-PA 326..587 53..320 551 42.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16994-PA 589 GD16994-PA 326..588 53..320 578 42.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23767-PA 324 GJ23767-PA 1..320 1..318 1263 72.5 Plus
Dvir\GJ16723-PA 618 GJ16723-PA 357..617 55..320 554 41 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11216-PA 322 GK11216-PA 14..319 15..320 1300 75.2 Plus
Dwil\GK19979-PA 612 GK19979-PA 351..611 55..320 565 41 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24349-PA 322 GE24349-PA 1..321 1..321 1542 88.2 Plus
Dyak\GE15899-PA 612 GE15899-PA 324..568 55..304 518 41.4 Plus

LD39912.hyp Sequence

Translation from 128 to 1096

> LD39912.hyp
MDAVQQQTNSTSNIDSAKCQKLKRFVIVGLLITIGILSWHFYEYFHSKPL
PKTPDDVLTLSKNLYAEETEVSPYLYKVNLQGKTTSGAHDDRAPRNLFEL
HQDLLARDANSTTALLMRLFDNYELDVAVQEHPTPEHVQEQYDFLRAVMG
TRVMKLTMRFLVHKDIVSVEYDDQLRLLQELWFTPYSRGRGIVGSSSFEH
VFMAEIRDQKVLGLHNWLYFADQEQRGNVDYKGWLNHKEMGKHNQMVLSV
RYTFHNINKPVNGFFVGISPELDMALYTACFLATAKEEPCHIQLGHASAT
IVSHEWKWNGMRLIGTVYPDSS*

LD39912.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG3303-PA 322 CG3303-PA 1..322 1..322 1711 100 Plus
CG2145-PB 592 CG2145-PB 329..591 53..320 561 42.8 Plus
CG2145-PA 592 CG2145-PA 329..591 53..320 561 42.8 Plus