BDGP Sequence Production Resources |
Search the DGRC for LD40224
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 402 |
Well: | 24 |
Vector: | pOT2 |
Associated Gene/Transcript | CG6523-RA |
Protein status: | LD40224.pep: gold |
Preliminary Size: | 1001 |
Sequenced Size: | 841 |
Gene | Date | Evidence |
---|---|---|
CG6523 | 2001-01-01 | Release 2 assignment |
CG6537 | 2001-01-01 | Release 2 assignment |
CG6523 | 2001-10-10 | Blastp of sequenced clone |
CG6523 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6523 | 2008-04-29 | Release 5.5 accounting |
CG6523 | 2008-08-15 | Release 5.9 accounting |
CG6523 | 2008-12-18 | 5.12 accounting |
841 bp (841 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061456
> LD40224.complete AATTCGGTCTGCTTTTTGTAAATTTTGCTTGTCCAGCAAATTTAGTTAAA TAATTCAAAGAAATCATGCCCGTGGTGAACGTGTCGGCTGCCGAGGAGTA CCAGAAGTACATTAATGCGGATAAGACGACCGTAGCTCTATTCGCCGCCG AATGGGCAGAGCAATGCGGTCAGGTGAAAGACGCGCTGGAGGAGCTGGCC AAGATTACTGGCGAAAAACTGCAGTTCATCAGCCTAAACGCTGAACAATT TCCCGAGATTTCCATGAAACATCAGATCGAGGCCGTGCCCACAGTCATAT TCTTCGCCAAGGGCTCCGCCGTTGACCGTGTCGATGGTGTAGACATCGCC GCCATAAGCGCCAAATCCAAAAAGTTGGCCGAAAACGCAAGCAGCGCGGC GGCAACAGGACAAACGTTGGAGGAACGCCTAAAGGCCCTAATCAATACAG CTCCGCTGATGATATTCATGAAGGGCGACCGAAATGGACCGCGTTGCGGA TTCTCCAAGCAGCTCATCGGCATTGTGAACGAAACCAACTTGCCGTACGA GACATTTGACATCCTCGGCGACGAAGAAGTGCGTCAAGGCCTGAAAACCT ACTCCGACTGGCCCACATATCCCCAGGTTTACGTCAAGGGTGAACTTATC GGCGGACTCGATATTATTAAGGAACTGCTGGCGAACAATGAGCTCGAGTC CACGCTAAAGGGCTAATTCCATCGGATTGCATCTACTCCTACAGACACCA TAAACCAGAAACAAATTTTTAGCTAGATCCTTAGACTTTTTAATGGTTTA ATAAAGGATTTTTGCTACAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6523-RA | 944 | CG6523-RA | 34..852 | 1..819 | 4095 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 13365806..13366085 | 539..818 | 1400 | 100 | Plus |
chr2L | 23010047 | chr2L | 13365141..13365415 | 1..275 | 1375 | 100 | Plus |
chr2L | 23010047 | chr2L | 13365477..13365742 | 273..538 | 1330 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 13367131..13367411 | 539..819 | 1405 | 100 | Plus |
2L | 23513712 | 2L | 13366466..13366740 | 1..275 | 1375 | 100 | Plus |
2L | 23513712 | 2L | 13366802..13367067 | 273..538 | 1330 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 13367131..13367411 | 539..819 | 1405 | 100 | Plus |
2L | 23513712 | 2L | 13366466..13366740 | 1..275 | 1375 | 100 | Plus |
2L | 23513712 | 2L | 13366802..13367067 | 273..538 | 1330 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 13365806..13366085 | 539..818 | 100 | Plus | |
chr2L | 13365141..13365415 | 1..275 | 100 | -> | Plus |
chr2L | 13365480..13365742 | 276..538 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6523-RA | 1..651 | 66..716 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6523-RA | 1..651 | 66..716 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6523-RA | 1..651 | 66..716 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6523-RA | 1..651 | 66..716 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6523-RA | 1..651 | 66..716 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6523-RA | 1..818 | 1..818 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6523-RA | 1..818 | 1..818 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6523-RA | 20..837 | 1..818 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6523-RA | 1..818 | 1..818 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6523-RA | 20..837 | 1..818 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 13366466..13366740 | 1..275 | 100 | -> | Plus |
2L | 13366805..13367067 | 276..538 | 100 | -> | Plus |
2L | 13367131..13367410 | 539..818 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 13366466..13366740 | 1..275 | 100 | -> | Plus |
2L | 13366805..13367067 | 276..538 | 100 | -> | Plus |
2L | 13367131..13367410 | 539..818 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 13366466..13366740 | 1..275 | 100 | -> | Plus |
2L | 13366805..13367067 | 276..538 | 100 | -> | Plus |
2L | 13367131..13367410 | 539..818 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 13366805..13367067 | 276..538 | 100 | -> | Plus |
arm_2L | 13366466..13366740 | 1..275 | 100 | -> | Plus |
arm_2L | 13367131..13367410 | 539..818 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 13366805..13367067 | 276..538 | 100 | -> | Plus |
2L | 13367131..13367410 | 539..818 | 100 | Plus | |
2L | 13366466..13366740 | 1..275 | 100 | -> | Plus |
Translation from 65 to 715
> LD40224.hyp MPVVNVSAAEEYQKYINADKTTVALFAAEWAEQCGQVKDALEELAKITGE KLQFISLNAEQFPEISMKHQIEAVPTVIFFAKGSAVDRVDGVDIAAISAK SKKLAENASSAAATGQTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQL IGIVNETNLPYETFDILGDEEVRQGLKTYSDWPTYPQVYVKGELIGGLDI IKELLANNELESTLKG*
Translation from 65 to 715
> LD40224.pep MPVVNVSAAEEYQKYINADKTTVALFAAEWAEQCGQVKDALEELAKITGE KLQFISLNAEQFPEISMKHQIEAVPTVIFFAKGSAVDRVDGVDIAAISAK SKKLAENASSAAATGQTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQL IGIVNETNLPYETFDILGDEEVRQGLKTYSDWPTYPQVYVKGELIGGLDI IKELLANNELESTLKG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23121-PA | 216 | GF23121-PA | 1..216 | 1..216 | 964 | 87 | Plus |
Dana\GF19438-PA | 175 | GF19438-PA | 57..150 | 122..215 | 238 | 42.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23842-PA | 216 | GG23842-PA | 1..216 | 1..216 | 1123 | 98.6 | Plus |
Dere\GG19444-PA | 169 | GG19444-PA | 54..147 | 122..215 | 237 | 40.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13459-PA | 216 | GH13459-PA | 1..216 | 1..216 | 957 | 85.6 | Plus |
Dgri\GH24287-PA | 143 | GH24287-PA | 30..123 | 122..215 | 239 | 42.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6523-PA | 216 | CG6523-PA | 1..216 | 1..216 | 1089 | 100 | Plus |
CG14407-PA | 159 | CG14407-PA | 15..137 | 94..215 | 243 | 37.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17213-PA | 216 | GI17213-PA | 1..216 | 1..216 | 942 | 83.3 | Plus |
Dmoj\GI16412-PA | 163 | GI16412-PA | 47..143 | 119..215 | 242 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26044-PA | 216 | GL26044-PA | 1..216 | 1..216 | 983 | 87.5 | Plus |
Dper\GL27096-PA | 171 | GL27096-PA | 53..146 | 122..215 | 239 | 42.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19662-PA | 216 | GA19662-PA | 1..216 | 1..216 | 986 | 88 | Plus |
Dpse\GA12959-PA | 171 | GA12959-PA | 53..146 | 122..215 | 239 | 42.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10421-PA | 216 | GM10421-PA | 1..216 | 1..216 | 1120 | 98.1 | Plus |
Dsec\GM12034-PA | 158 | GM12034-PA | 24..136 | 104..215 | 249 | 38.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23891-PA | 216 | GD23891-PA | 1..216 | 1..216 | 1120 | 98.1 | Plus |
Dsim\GD15835-PA | 158 | GD15835-PA | 43..136 | 122..215 | 236 | 40.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17969-PA | 216 | GJ17969-PA | 1..216 | 1..216 | 984 | 86.1 | Plus |
Dvir\GJ17033-PA | 163 | GJ17033-PA | 47..143 | 119..215 | 254 | 42.3 | Plus |