Clone LD40224 Report

Search the DGRC for LD40224

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:402
Well:24
Vector:pOT2
Associated Gene/TranscriptCG6523-RA
Protein status:LD40224.pep: gold
Preliminary Size:1001
Sequenced Size:841

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6523 2001-01-01 Release 2 assignment
CG6537 2001-01-01 Release 2 assignment
CG6523 2001-10-10 Blastp of sequenced clone
CG6523 2003-01-01 Sim4 clustering to Release 3
CG6523 2008-04-29 Release 5.5 accounting
CG6523 2008-08-15 Release 5.9 accounting
CG6523 2008-12-18 5.12 accounting

Clone Sequence Records

LD40224.complete Sequence

841 bp (841 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061456

> LD40224.complete
AATTCGGTCTGCTTTTTGTAAATTTTGCTTGTCCAGCAAATTTAGTTAAA
TAATTCAAAGAAATCATGCCCGTGGTGAACGTGTCGGCTGCCGAGGAGTA
CCAGAAGTACATTAATGCGGATAAGACGACCGTAGCTCTATTCGCCGCCG
AATGGGCAGAGCAATGCGGTCAGGTGAAAGACGCGCTGGAGGAGCTGGCC
AAGATTACTGGCGAAAAACTGCAGTTCATCAGCCTAAACGCTGAACAATT
TCCCGAGATTTCCATGAAACATCAGATCGAGGCCGTGCCCACAGTCATAT
TCTTCGCCAAGGGCTCCGCCGTTGACCGTGTCGATGGTGTAGACATCGCC
GCCATAAGCGCCAAATCCAAAAAGTTGGCCGAAAACGCAAGCAGCGCGGC
GGCAACAGGACAAACGTTGGAGGAACGCCTAAAGGCCCTAATCAATACAG
CTCCGCTGATGATATTCATGAAGGGCGACCGAAATGGACCGCGTTGCGGA
TTCTCCAAGCAGCTCATCGGCATTGTGAACGAAACCAACTTGCCGTACGA
GACATTTGACATCCTCGGCGACGAAGAAGTGCGTCAAGGCCTGAAAACCT
ACTCCGACTGGCCCACATATCCCCAGGTTTACGTCAAGGGTGAACTTATC
GGCGGACTCGATATTATTAAGGAACTGCTGGCGAACAATGAGCTCGAGTC
CACGCTAAAGGGCTAATTCCATCGGATTGCATCTACTCCTACAGACACCA
TAAACCAGAAACAAATTTTTAGCTAGATCCTTAGACTTTTTAATGGTTTA
ATAAAGGATTTTTGCTACAAAAAAAAAAAAAAAAAAAAAAA

LD40224.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG6523-RA 944 CG6523-RA 34..852 1..819 4095 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13365806..13366085 539..818 1400 100 Plus
chr2L 23010047 chr2L 13365141..13365415 1..275 1375 100 Plus
chr2L 23010047 chr2L 13365477..13365742 273..538 1330 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:34:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13367131..13367411 539..819 1405 100 Plus
2L 23513712 2L 13366466..13366740 1..275 1375 100 Plus
2L 23513712 2L 13366802..13367067 273..538 1330 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13367131..13367411 539..819 1405 100 Plus
2L 23513712 2L 13366466..13366740 1..275 1375 100 Plus
2L 23513712 2L 13366802..13367067 273..538 1330 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:59:41 has no hits.

LD40224.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:00:28 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13365806..13366085 539..818 100   Plus
chr2L 13365141..13365415 1..275 100 -> Plus
chr2L 13365480..13365742 276..538 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:22:31 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
CG6523-RA 1..651 66..716 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:35 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
CG6523-RA 1..651 66..716 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:38 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
CG6523-RA 1..651 66..716 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:38 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
CG6523-RA 1..651 66..716 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:49:08 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
CG6523-RA 1..651 66..716 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:35:16 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
CG6523-RA 1..818 1..818 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:35 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
CG6523-RA 1..818 1..818 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:38 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
CG6523-RA 20..837 1..818 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:19:39 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
CG6523-RA 1..818 1..818 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:49:08 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
CG6523-RA 20..837 1..818 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:28 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13366466..13366740 1..275 100 -> Plus
2L 13366805..13367067 276..538 100 -> Plus
2L 13367131..13367410 539..818 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:28 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13366466..13366740 1..275 100 -> Plus
2L 13366805..13367067 276..538 100 -> Plus
2L 13367131..13367410 539..818 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:28 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13366466..13366740 1..275 100 -> Plus
2L 13366805..13367067 276..538 100 -> Plus
2L 13367131..13367410 539..818 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:38 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13366805..13367067 276..538 100 -> Plus
arm_2L 13366466..13366740 1..275 100 -> Plus
arm_2L 13367131..13367410 539..818 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:56:21 Download gff for LD40224.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13366805..13367067 276..538 100 -> Plus
2L 13367131..13367410 539..818 100   Plus
2L 13366466..13366740 1..275 100 -> Plus

LD40224.hyp Sequence

Translation from 65 to 715

> LD40224.hyp
MPVVNVSAAEEYQKYINADKTTVALFAAEWAEQCGQVKDALEELAKITGE
KLQFISLNAEQFPEISMKHQIEAVPTVIFFAKGSAVDRVDGVDIAAISAK
SKKLAENASSAAATGQTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQL
IGIVNETNLPYETFDILGDEEVRQGLKTYSDWPTYPQVYVKGELIGGLDI
IKELLANNELESTLKG*

LD40224.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG6523-PA 216 CG6523-PA 1..216 1..216 1089 100 Plus
CG14407-PA 159 CG14407-PA 15..137 94..215 243 37.4 Plus

LD40224.pep Sequence

Translation from 65 to 715

> LD40224.pep
MPVVNVSAAEEYQKYINADKTTVALFAAEWAEQCGQVKDALEELAKITGE
KLQFISLNAEQFPEISMKHQIEAVPTVIFFAKGSAVDRVDGVDIAAISAK
SKKLAENASSAAATGQTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQL
IGIVNETNLPYETFDILGDEEVRQGLKTYSDWPTYPQVYVKGELIGGLDI
IKELLANNELESTLKG*

LD40224.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23121-PA 216 GF23121-PA 1..216 1..216 964 87 Plus
Dana\GF19438-PA 175 GF19438-PA 57..150 122..215 238 42.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23842-PA 216 GG23842-PA 1..216 1..216 1123 98.6 Plus
Dere\GG19444-PA 169 GG19444-PA 54..147 122..215 237 40.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13459-PA 216 GH13459-PA 1..216 1..216 957 85.6 Plus
Dgri\GH24287-PA 143 GH24287-PA 30..123 122..215 239 42.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG6523-PA 216 CG6523-PA 1..216 1..216 1089 100 Plus
CG14407-PA 159 CG14407-PA 15..137 94..215 243 37.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17213-PA 216 GI17213-PA 1..216 1..216 942 83.3 Plus
Dmoj\GI16412-PA 163 GI16412-PA 47..143 119..215 242 41.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26044-PA 216 GL26044-PA 1..216 1..216 983 87.5 Plus
Dper\GL27096-PA 171 GL27096-PA 53..146 122..215 239 42.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19662-PA 216 GA19662-PA 1..216 1..216 986 88 Plus
Dpse\GA12959-PA 171 GA12959-PA 53..146 122..215 239 42.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10421-PA 216 GM10421-PA 1..216 1..216 1120 98.1 Plus
Dsec\GM12034-PA 158 GM12034-PA 24..136 104..215 249 38.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23891-PA 216 GD23891-PA 1..216 1..216 1120 98.1 Plus
Dsim\GD15835-PA 158 GD15835-PA 43..136 122..215 236 40.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17969-PA 216 GJ17969-PA 1..216 1..216 984 86.1 Plus
Dvir\GJ17033-PA 163 GJ17033-PA 47..143 119..215 254 42.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14839-PA 217 GK14839-PA 1..217 1..216 958 85.7 Plus
Dwil\GK18554-PA 166 GK18554-PA 23..144 90..215 244 34.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18647-PA 216 GE18647-PA 1..216 1..216 1124 98.6 Plus
Dyak\GE16098-PA 169 GE16098-PA 54..147 122..215 237 40.4 Plus