Clone LD40493 Report

Search the DGRC for LD40493

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:404
Well:93
Vector:pOT2
Associated Gene/TranscriptTFAM-RA
Protein status:LD40493.pep: gold
Preliminary Size:1176
Sequenced Size:1050

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4217 2001-01-01 Release 2 assignment
CG4217 2003-01-01 Sim4 clustering to Release 3
CG4217 2003-01-13 Blastp of sequenced clone
TFAM 2008-04-29 Release 5.5 accounting
TFAM 2008-08-15 Release 5.9 accounting
TFAM 2008-12-18 5.12 accounting

Clone Sequence Records

LD40493.complete Sequence

1050 bp (1050 high quality bases) assembled on 2003-01-13

GenBank Submission: AY061457

> LD40493.complete
CGGCCTAGAATGCCGCATTTTTTACGTAAATCCTTTTTTCCGTAAATGCA
ACAAGTTCCCCGTGATTTTTAAATAGCTTACAACGCAAGGAAGCAGGTTC
GCCATTGAGATCATGATCTACACCACAACACTGATGTCCTCGCGCGGCGG
CCTCATCGGCTCGCTGATCAACAAAGTCAGGCCCCTAGCAGCCGCCAGCA
TCAGCAACACTCCGGCGGTGCCGTCGAAGACCCTGGAGGAGCAGTTGGGC
CTGCCGCCGCGACCAAAGAAACCGCTGACTCCCTACTTTCGCTTCATGCG
GGAGCAGCGGCCCAAGCTGAAGGCTGCCAATCCCCAGATTACCACCGTCG
AGGTGGTGCGCCAGCTGTCTAAGAACTGGTCCGATGCCGATGCGCAGCTG
AAGGAGCGCCTGCAGGCCGAGTTCAAGCGGGACCAACAAATCTACGTGGA
GGAGCGAACAAAGTACGATGCCACACTCACGGAGGAGCAGCGGGCCGAGA
TCAAGCAGCTCAAGCAGGACCTCGTTGACGCCAAGGAGCGCCGCCAGCTG
CGCAAGCGGGTCAAGGAGCTGGGGCGACCCAAAAAGCCCGCTTCGGCCTT
CCTGCGATTCATCGCCAGCGAACGTATCAACACTCCGCAGGGCGACAAGC
AAACCTACCGCGAGTGGCACCAAAAGACCACCGCCAAGTGGACTCGCCTT
TCCGACTCCGAGAAGGAGGTCTACATGCAGGAGTCGCGCAAGGAGATGGA
GCTCTACAGGAAAGCGATTTCCGTTTGGGAGGAGAAGATGATCCGCCTGG
GCCACATCGACGTGGTGCGTCACGGAAATCTTATCGATCCACCTGAGCCA
AAGCCCCGCAAGACGCTGGCCTCCAAAGATATATAGTTGTAGCTGCTCGG
CCCGCCCTCTTCCATCACATAATTCACAAATCATGCATCATTCTGTTTTT
CGTTTTTCTTTTTCGATCGCCAATTGTTAAGGTTAGGGCATTAAAGATTA
AATGCTAGCCAGCCAGCATAAGTTTAACTTAAAAAAAAAAAAAAAAAAAA

LD40493.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
TFAM-RB 1262 TFAM-RB 294..1148 179..1033 4275 100 Plus
TFAM.b 1543 TFAM.b 294..1148 179..1033 4275 100 Plus
TFAM.d 1782 TFAM.d 294..1148 179..1033 4275 100 Plus
TFAM-RB 1262 TFAM-RB 35..216 1..182 910 100 Plus
TFAM.b 1543 TFAM.b 35..216 1..182 910 100 Plus
TFAM.d 1782 TFAM.d 35..216 1..182 910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16400059..16400640 760..179 2910 100 Minus
chr3R 27901430 chr3R 16399265..16399537 1030..758 1365 100 Minus
chr3R 27901430 chr3R 16400718..16400899 182..1 910 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:35:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20576145..20576726 760..179 2910 100 Minus
3R 32079331 3R 20575348..20575623 1033..758 1380 100 Minus
3R 32079331 3R 20576804..20576985 182..1 910 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20316976..20317557 760..179 2910 100 Minus
3R 31820162 3R 20316179..20316454 1033..758 1380 100 Minus
3R 31820162 3R 20317635..20317816 182..1 910 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:32:18 has no hits.

LD40493.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:33:13 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16399265..16399535 760..1030 100 <- Minus
chr3R 16400060..16400638 181..759 100 <- Minus
chr3R 16400720..16400899 1..180 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:22:54 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 1..774 113..886 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:57:27 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 1..774 113..886 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:07:29 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 1..774 113..886 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:48:16 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 1..774 113..886 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:06:14 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 1..774 113..886 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:13:35 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 35..1064 1..1030 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:57:27 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 35..1064 1..1030 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:07:29 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 26..1055 1..1030 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:48:16 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 35..1064 1..1030 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:06:14 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
TFAM-RA 26..1055 1..1030 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:33:13 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20575351..20575621 760..1030 100 <- Minus
3R 20576146..20576724 181..759 100 <- Minus
3R 20576806..20576985 1..180 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:33:13 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20575351..20575621 760..1030 100 <- Minus
3R 20576146..20576724 181..759 100 <- Minus
3R 20576806..20576985 1..180 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:33:13 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20575351..20575621 760..1030 100 <- Minus
3R 20576146..20576724 181..759 100 <- Minus
3R 20576806..20576985 1..180 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:07:29 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16401073..16401343 760..1030 100 <- Minus
arm_3R 16401868..16402446 181..759 100 <- Minus
arm_3R 16402528..16402707 1..180 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:19:40 Download gff for LD40493.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20316182..20316452 760..1030 100 <- Minus
3R 20316977..20317555 181..759 100 <- Minus
3R 20317637..20317816 1..180 100   Minus

LD40493.pep Sequence

Translation from 112 to 885

> LD40493.pep
MIYTTTLMSSRGGLIGSLINKVRPLAAASISNTPAVPSKTLEEQLGLPPR
PKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERL
QAEFKRDQQIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRV
KELGRPKKPASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSE
KEVYMQESRKEMELYRKAISVWEEKMIRLGHIDVVRHGNLIDPPEPKPRK
TLASKDI*

LD40493.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18333-PA 257 GF18333-PA 1..256 1..256 1161 82.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15368-PA 257 GG15368-PA 1..256 1..256 1270 93 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14163-PA 252 GH14163-PA 5..250 10..255 1000 74.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:48
Subject Length Description Subject Range Query Range Score Percent Strand
TFAM-PA 257 CG4217-PA 1..257 1..257 1314 100 Plus
TFAM-PB 284 CG4217-PB 1..284 1..257 1276 90.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10534-PA 256 GI10534-PA 1..255 1..256 979 78.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13929-PA 256 GL13929-PA 1..249 1..250 1082 80.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18041-PA 256 GA18041-PA 1..249 1..250 1082 80.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23183-PA 257 GM23183-PA 1..257 1..257 1343 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20056-PA 257 GD20056-PA 1..257 1..257 1341 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24186-PA 256 GJ24186-PA 1..255 1..256 1022 78.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22718-PA 256 GK22718-PA 1..255 1..256 1080 78.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25063-PA 257 GE25063-PA 1..256 1..256 1271 93.8 Plus

LD40493.hyp Sequence

Translation from 112 to 885

> LD40493.hyp
MIYTTTLMSSRGGLIGSLINKVRPLAAASISNTPAVPSKTLEEQLGLPPR
PKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERL
QAEFKRDQQIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRV
KELGRPKKPASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSE
KEVYMQESRKEMELYRKAISVWEEKMIRLGHIDVVRHGNLIDPPEPKPRK
TLASKDI*

LD40493.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:34
Subject Length Description Subject Range Query Range Score Percent Strand
TFAM-PA 257 CG4217-PA 1..257 1..257 1314 100 Plus
TFAM-PB 284 CG4217-PB 1..284 1..257 1276 90.5 Plus