BDGP Sequence Production Resources |
Search the DGRC for LD40504
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 405 |
Well: | 4 |
Vector: | pOT2 |
Associated Gene/Transcript | PQBP1-RA |
Protein status: | LD40504.pep: gold |
Preliminary Size: | 967 |
Sequenced Size: | 828 |
Gene | Date | Evidence |
---|---|---|
CG11820 | 2001-11-29 | Blastp of sequenced clone |
CG11820 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11820 | 2008-04-29 | Release 5.5 accounting |
CG11820 | 2008-08-15 | Release 5.9 accounting |
CG11820 | 2008-12-18 | 5.12 accounting |
828 bp (828 high quality bases) assembled on 2001-11-29
GenBank Submission: AY069638
> LD40504.complete ATTTAAACTAACAATAGAATAATAGCAAAATGAGCCTGCCAGCTGCACTA TTGCAGCGCCTGAAGAAGCGCGGACTTGTGACCAAACAGTCGGGAGCAGC ACCGATTTCAGAAGCTATAGAAGAGATTATAGCCGAGAACTACGATGACG ATGACAAGAGCGGCCCTTACCCGTACAAGGAGGACACATCGCCGGAGCCC AAGCGCAGGAGCGTCGAGGAGAAGTTCTGGTCGCACCGCATCAAGGAGCG GATCGGCGTGAACGAGTCCTACCATGGCTACAAGCTGTGTCCCAACAAAT ACAACATATACCACAAGTGCTCGCTGTACTGCGTAAACAAGTTCAACAGC TCGCCGCTTTCGCAGCCCAGCCATAGGTATCTCAAGCGCTACAAGAGATT GCTGCGGAAGTATCCACTGGAGGCGGGCTGGAAGGATGTCTACGATAAGG GCTGCAAGGCGTTTTACTTCTATAACTCGACCACACAGACTGTTTCGTGG CTACCTCCTTCGCATCCCAAAGCACGGATCACCAACAGCGCCGCAGTGTT TCGCAGACAACTGGCCAACTCCAACGATGAGTTCAACTTCGATACCAACA TGGTTCAGCCCAAGTCTTCTAACCAAAATGAACCCGACGAGCCCGACGTA TTCGTTCCCGCCAAGAAGCAAAAGTCCAGGGACCTGGAACGAAAAATCCA ACGACGTCGCCGTAATGATAACTAGCACTACTAACTAGCCATTTGACTTA TGAGCTGTAGATCGCTACTGTTCAAATAAAAATGAATAACTATGATAGAT ATTAAGGTTTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11820-RA | 872 | CG11820-RA | 63..872 | 1..810 | 4050 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 20889021..20889113 | 1..93 | 100 | -> | Plus |
chr3R | 20889174..20889890 | 94..810 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11820-RA | 1..696 | 30..725 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11820-RA | 1..696 | 30..725 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PQBP1-RA | 1..696 | 30..725 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11820-RA | 1..696 | 30..725 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PQBP1-RA | 1..696 | 30..725 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11820-RA | 46..855 | 1..810 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11820-RA | 45..854 | 1..810 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PQBP1-RA | 59..868 | 1..810 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11820-RA | 46..855 | 1..810 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PQBP1-RA | 59..868 | 1..810 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25065849..25065941 | 1..93 | 100 | -> | Plus |
3R | 25066002..25066718 | 94..810 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25065849..25065941 | 1..93 | 100 | -> | Plus |
3R | 25066002..25066718 | 94..810 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25065849..25065941 | 1..93 | 100 | -> | Plus |
3R | 25066002..25066718 | 94..810 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 20891571..20891663 | 1..93 | 100 | -> | Plus |
arm_3R | 20891724..20892440 | 94..810 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24806833..24807549 | 94..810 | 100 | Plus | |
3R | 24806680..24806772 | 1..93 | 100 | -> | Plus |
Translation from 29 to 724
> LD40504.pep MSLPAALLQRLKKRGLVTKQSGAAPISEAIEEIIAENYDDDDKSGPYPYK EDTSPEPKRRSVEEKFWSHRIKERIGVNESYHGYKLCPNKYNIYHKCSLY CVNKFNSSPLSQPSHRYLKRYKRLLRKYPLEAGWKDVYDKGCKAFYFYNS TTQTVSWLPPSHPKARITNSAAVFRRQLANSNDEFNFDTNMVQPKSSNQN EPDEPDVFVPAKKQKSRDLERKIQRRRRNDN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17884-PA | 237 | GF17884-PA | 1..237 | 1..231 | 948 | 76.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11354-PA | 231 | GG11354-PA | 1..231 | 1..231 | 1159 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18022-PA | 229 | GH18022-PA | 1..228 | 1..228 | 673 | 58.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
PQBP1-PA | 231 | CG11820-PA | 1..231 | 1..231 | 1242 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23959-PA | 226 | GI23959-PA | 1..225 | 1..228 | 684 | 58.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21948-PA | 233 | GL21948-PA | 1..233 | 1..231 | 798 | 63.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17795-PA | 231 | GM17795-PA | 1..231 | 1..231 | 1205 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21167-PA | 231 | GD21167-PA | 1..231 | 1..231 | 1215 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11169-PA | 226 | GJ11169-PA | 1..225 | 1..228 | 591 | 55.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13879-PA | 239 | GK13879-PA | 1..236 | 1..228 | 789 | 62.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23551-PA | 231 | GE23551-PA | 1..231 | 1..231 | 1166 | 93.1 | Plus |
Translation from 29 to 724
> LD40504.hyp MSLPAALLQRLKKRGLVTKQSGAAPISEAIEEIIAENYDDDDKSGPYPYK EDTSPEPKRRSVEEKFWSHRIKERIGVNESYHGYKLCPNKYNIYHKCSLY CVNKFNSSPLSQPSHRYLKRYKRLLRKYPLEAGWKDVYDKGCKAFYFYNS TTQTVSWLPPSHPKARITNSAAVFRRQLANSNDEFNFDTNMVQPKSSNQN EPDEPDVFVPAKKQKSRDLERKIQRRRRNDN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
PQBP1-PA | 231 | CG11820-PA | 1..231 | 1..231 | 1242 | 100 | Plus |