Clone LD40504 Report

Search the DGRC for LD40504

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:405
Well:4
Vector:pOT2
Associated Gene/TranscriptPQBP1-RA
Protein status:LD40504.pep: gold
Preliminary Size:967
Sequenced Size:828

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11820 2001-11-29 Blastp of sequenced clone
CG11820 2003-01-01 Sim4 clustering to Release 3
CG11820 2008-04-29 Release 5.5 accounting
CG11820 2008-08-15 Release 5.9 accounting
CG11820 2008-12-18 5.12 accounting

Clone Sequence Records

LD40504.complete Sequence

828 bp (828 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069638

> LD40504.complete
ATTTAAACTAACAATAGAATAATAGCAAAATGAGCCTGCCAGCTGCACTA
TTGCAGCGCCTGAAGAAGCGCGGACTTGTGACCAAACAGTCGGGAGCAGC
ACCGATTTCAGAAGCTATAGAAGAGATTATAGCCGAGAACTACGATGACG
ATGACAAGAGCGGCCCTTACCCGTACAAGGAGGACACATCGCCGGAGCCC
AAGCGCAGGAGCGTCGAGGAGAAGTTCTGGTCGCACCGCATCAAGGAGCG
GATCGGCGTGAACGAGTCCTACCATGGCTACAAGCTGTGTCCCAACAAAT
ACAACATATACCACAAGTGCTCGCTGTACTGCGTAAACAAGTTCAACAGC
TCGCCGCTTTCGCAGCCCAGCCATAGGTATCTCAAGCGCTACAAGAGATT
GCTGCGGAAGTATCCACTGGAGGCGGGCTGGAAGGATGTCTACGATAAGG
GCTGCAAGGCGTTTTACTTCTATAACTCGACCACACAGACTGTTTCGTGG
CTACCTCCTTCGCATCCCAAAGCACGGATCACCAACAGCGCCGCAGTGTT
TCGCAGACAACTGGCCAACTCCAACGATGAGTTCAACTTCGATACCAACA
TGGTTCAGCCCAAGTCTTCTAACCAAAATGAACCCGACGAGCCCGACGTA
TTCGTTCCCGCCAAGAAGCAAAAGTCCAGGGACCTGGAACGAAAAATCCA
ACGACGTCGCCGTAATGATAACTAGCACTACTAACTAGCCATTTGACTTA
TGAGCTGTAGATCGCTACTGTTCAAATAAAAATGAATAACTATGATAGAT
ATTAAGGTTTAAAAAAAAAAAAAAAAAA

LD40504.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG11820-RA 872 CG11820-RA 63..872 1..810 4050 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20889173..20889890 93..810 3575 99.9 Plus
chr3R 27901430 chr3R 20889021..20889114 1..94 470 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:35:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25066001..25066723 93..815 3615 100 Plus
3R 32079331 3R 25065849..25065942 1..94 470 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24806832..24807554 93..815 3615 100 Plus
3R 31820162 3R 24806680..24806773 1..94 470 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:32:21 has no hits.

LD40504.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:33:15 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20889021..20889113 1..93 100 -> Plus
chr3R 20889174..20889890 94..810 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:22:55 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11820-RA 1..696 30..725 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:24:32 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11820-RA 1..696 30..725 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:07:32 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
PQBP1-RA 1..696 30..725 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:51:34 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11820-RA 1..696 30..725 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:06:17 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
PQBP1-RA 1..696 30..725 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:00:06 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11820-RA 46..855 1..810 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:24:31 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11820-RA 45..854 1..810 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:07:32 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
PQBP1-RA 59..868 1..810 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:51:34 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11820-RA 46..855 1..810 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:06:17 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
PQBP1-RA 59..868 1..810 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:33:15 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25065849..25065941 1..93 100 -> Plus
3R 25066002..25066718 94..810 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:33:15 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25065849..25065941 1..93 100 -> Plus
3R 25066002..25066718 94..810 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:33:15 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25065849..25065941 1..93 100 -> Plus
3R 25066002..25066718 94..810 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:07:32 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20891571..20891663 1..93 100 -> Plus
arm_3R 20891724..20892440 94..810 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:27:44 Download gff for LD40504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24806833..24807549 94..810 100   Plus
3R 24806680..24806772 1..93 100 -> Plus

LD40504.pep Sequence

Translation from 29 to 724

> LD40504.pep
MSLPAALLQRLKKRGLVTKQSGAAPISEAIEEIIAENYDDDDKSGPYPYK
EDTSPEPKRRSVEEKFWSHRIKERIGVNESYHGYKLCPNKYNIYHKCSLY
CVNKFNSSPLSQPSHRYLKRYKRLLRKYPLEAGWKDVYDKGCKAFYFYNS
TTQTVSWLPPSHPKARITNSAAVFRRQLANSNDEFNFDTNMVQPKSSNQN
EPDEPDVFVPAKKQKSRDLERKIQRRRRNDN*

LD40504.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17884-PA 237 GF17884-PA 1..237 1..231 948 76.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11354-PA 231 GG11354-PA 1..231 1..231 1159 93.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18022-PA 229 GH18022-PA 1..228 1..228 673 58.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
PQBP1-PA 231 CG11820-PA 1..231 1..231 1242 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23959-PA 226 GI23959-PA 1..225 1..228 684 58.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21948-PA 233 GL21948-PA 1..233 1..231 798 63.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17795-PA 231 GM17795-PA 1..231 1..231 1205 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21167-PA 231 GD21167-PA 1..231 1..231 1215 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11169-PA 226 GJ11169-PA 1..225 1..228 591 55.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13879-PA 239 GK13879-PA 1..236 1..228 789 62.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23551-PA 231 GE23551-PA 1..231 1..231 1166 93.1 Plus

LD40504.hyp Sequence

Translation from 29 to 724

> LD40504.hyp
MSLPAALLQRLKKRGLVTKQSGAAPISEAIEEIIAENYDDDDKSGPYPYK
EDTSPEPKRRSVEEKFWSHRIKERIGVNESYHGYKLCPNKYNIYHKCSLY
CVNKFNSSPLSQPSHRYLKRYKRLLRKYPLEAGWKDVYDKGCKAFYFYNS
TTQTVSWLPPSHPKARITNSAAVFRRQLANSNDEFNFDTNMVQPKSSNQN
EPDEPDVFVPAKKQKSRDLERKIQRRRRNDN*

LD40504.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
PQBP1-PA 231 CG11820-PA 1..231 1..231 1242 100 Plus