BDGP Sequence Production Resources |
Search the DGRC for LD40766
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 407 |
Well: | 66 |
Vector: | pOT2 |
Associated Gene/Transcript | CG1969-RA |
Protein status: | LD40766.pep: gold |
Preliminary Size: | 1409 |
Sequenced Size: | 1226 |
Gene | Date | Evidence |
---|---|---|
CG1969 | 2001-01-01 | Release 2 assignment |
CG1969 | 2001-09-19 | Blastp of sequenced clone |
CG1969 | 2008-04-29 | Release 5.5 accounting |
CG1969 | 2008-08-15 | Release 5.9 accounting |
CG1969 | 2008-12-18 | 5.12 accounting |
1226 bp (1226 high quality bases) assembled on 2001-09-19
GenBank Submission: AY058687
> LD40766.complete GCGTCACTTGCTGACGTGTGAAGTCCACTGCGAAAATGGTGCAACTTACG GAGGAGACATATCTGTACGATCCTAATCTGCTGCTAAAGCTGGACTTTCA TCGCAGTCCCGCCAACTTTAAGCCCTTCATATCGGCGGCCAATCCCGGCG AGCCCTGGATGAAAGTGCGTCCTCTCAAGGACACCGACTACGATCGTGGA TTCCTGCAGCTGCTCTCGCAACTCACCCATGTCGGCAATGTGAATCGTAC GCAGTTCTTGACCCGCTTTTCGCAGATGAAAGCCAGTGGGGACTACTTTG TCACCGTCATTGAGGACACTCGCAAGAATGAGATTATTGGAGCTGCATCC TTGGTGATCGAGCGCAAGTTCATCCATAACTGTGCTGTGCGTGGCCGTCT AGAGGATGTGGTGGTCAATGACACGTATCGCGGGAAGCAACTGGGAAAAC TGATCGTGGTCACCGTATCGCTGCTGGCCGAGGAACTGGGCTGCTACAAA ATGTCGCTGGACTGCAAGGACAAGCTGATCAAGTTCTATGAGTCGCTGGG CTATGTGGCCATTCCCGGAAACTCCAACTCCATGACGATTCGCTACGATG AGGGGCCAACGCTCAAGCGGAATGCTACCTCAGCCGGCTCCAGTGGAACA GTGGGCGACTCCTGCCAAACTGTGAGCCTCGATTTTGCCTCTTGACAATT AGCCGCCAACGCTGCTCCAAAGTCCAAGCTTTGAGTGGGAGCACCCCATC TCAAAGTTACAAATGCGCGAAGCGCAATGCAACAAAACTAAAATTGGATT CTAAGAAAACATTAAATGCATATAGGCATTGCCAAAATTCCATTGCGCTG AGGGCATGATGGATTTTTGGACAGCGCTGGCTGGCGGTGGTGTCCTTGTG GACGGACGTGCTTGTCCACCCACCCGCGAGGACATACAATTAGATATTTA GTTAAAGACAACCGCAACATATGTTGCTCTCTGTTTTTAATCCCTACAGA ACTCTCAATTTTATAATTTTTTCTCCCCTTTCTGCTACTGAATGTGCGGC TCGACCTCTCAACTCCAAGGTGGTTGTAATATTACCTTTTAAGAGCACCT TCATCAAGTAGCCCTAAGATTGAAACACTCGCATAACTGTTAAACTGTTA TTAACACTAATCAACAATAGCGATTAAAACCCAATACGAATCTTTCAAAA ACCTTTAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG1969-RA | 1364 | CG1969-RA | 111..1318 | 1..1208 | 6040 | 100 | Plus |
CG1969.d | 1252 | CG1969.d | 69..1227 | 50..1208 | 5795 | 100 | Plus |
CG1969.i | 2970 | CG1969.i | 1766..2924 | 50..1208 | 5795 | 100 | Plus |
CG1969.d | 1252 | CG1969.d | 32..70 | 1..39 | 195 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 25563752..25564506 | 452..1206 | 3640 | 98.8 | Plus |
chr3R | 27901430 | chr3R | 25563169..25563380 | 50..261 | 1030 | 99.1 | Plus |
chr3R | 27901430 | chr3R | 25563442..25563569 | 262..389 | 580 | 96.9 | Plus |
chr3R | 27901430 | chr3R | 25563630..25563693 | 389..452 | 305 | 98.4 | Plus |
chr3R | 27901430 | chr3R | 25562972..25563022 | 1..51 | 255 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 29741150..29741906 | 452..1208 | 3785 | 100 | Plus |
3R | 32079331 | 3R | 29740567..29740778 | 50..261 | 1060 | 100 | Plus |
3R | 32079331 | 3R | 29740840..29740967 | 262..389 | 640 | 100 | Plus |
3R | 32079331 | 3R | 29741028..29741091 | 389..452 | 320 | 100 | Plus |
3R | 32079331 | 3R | 29740370..29740420 | 1..51 | 255 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 29481981..29482737 | 452..1208 | 3785 | 100 | Plus |
3R | 31820162 | 3R | 29481398..29481609 | 50..261 | 1060 | 100 | Plus |
3R | 31820162 | 3R | 29481671..29481798 | 262..389 | 640 | 100 | Plus |
3R | 31820162 | 3R | 29481859..29481922 | 389..452 | 320 | 100 | Plus |
3R | 31820162 | 3R | 29481201..29481251 | 1..51 | 255 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 25563442..25563569 | 262..389 | 96 | -> | Plus |
chr3R | 25563631..25563692 | 390..451 | 98 | -> | Plus |
chr3R | 25562972..25563021 | 1..50 | 100 | -> | Plus |
chr3R | 25563170..25563380 | 51..261 | 99 | -> | Plus |
chr3R | 25563752..25564506 | 452..1206 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RA | 1..660 | 36..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RA | 1..660 | 36..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RF | 1..687 | 48..734 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RA | 1..660 | 36..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RF | 1..687 | 48..734 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RA | 1..1206 | 1..1206 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RA | 17..1222 | 1..1206 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RA | 20..1225 | 1..1206 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RA | 1..1206 | 1..1206 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RA | 20..1225 | 1..1206 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29740370..29740419 | 1..50 | 100 | -> | Plus |
3R | 29740568..29740778 | 51..261 | 100 | -> | Plus |
3R | 29740840..29740967 | 262..389 | 100 | -> | Plus |
3R | 29741029..29741090 | 390..451 | 100 | -> | Plus |
3R | 29741150..29741904 | 452..1206 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29740370..29740419 | 1..50 | 100 | -> | Plus |
3R | 29740568..29740778 | 51..261 | 100 | -> | Plus |
3R | 29740840..29740967 | 262..389 | 100 | -> | Plus |
3R | 29741029..29741090 | 390..451 | 100 | -> | Plus |
3R | 29741150..29741904 | 452..1206 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29740370..29740419 | 1..50 | 100 | -> | Plus |
3R | 29740568..29740778 | 51..261 | 100 | -> | Plus |
3R | 29740840..29740967 | 262..389 | 100 | -> | Plus |
3R | 29741029..29741090 | 390..451 | 100 | -> | Plus |
3R | 29741150..29741904 | 452..1206 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 25566092..25566141 | 1..50 | 100 | -> | Plus |
arm_3R | 25566290..25566500 | 51..261 | 100 | -> | Plus |
arm_3R | 25566562..25566689 | 262..389 | 100 | -> | Plus |
arm_3R | 25566751..25566812 | 390..451 | 100 | -> | Plus |
arm_3R | 25566872..25567626 | 452..1206 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29481671..29481798 | 262..389 | 100 | -> | Plus |
3R | 29481860..29481921 | 390..451 | 100 | -> | Plus |
3R | 29481399..29481609 | 51..261 | 100 | -> | Plus |
3R | 29481981..29482735 | 452..1206 | 100 | Plus | |
3R | 29481201..29481250 | 1..50 | 100 | -> | Plus |
Translation from 35 to 694
> LD40766.pep MVQLTEETYLYDPNLLLKLDFHRSPANFKPFISAANPGEPWMKVRPLKDT DYDRGFLQLLSQLTHVGNVNRTQFLTRFSQMKASGDYFVTVIEDTRKNEI IGAASLVIERKFIHNCAVRGRLEDVVVNDTYRGKQLGKLIVVTVSLLAEE LGCYKMSLDCKDKLIKFYESLGYVAIPGNSNSMTIRYDEGPTLKRNATSA GSSGTVGDSCQTVSLDFAS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23369-PA | 219 | GF23369-PA | 1..219 | 1..219 | 1137 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11689-PA | 219 | GG11689-PA | 1..219 | 1..219 | 1169 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14324-PA | 219 | GH14324-PA | 1..219 | 1..219 | 1024 | 87.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Gnpnat-PA | 219 | CG1969-PA | 1..219 | 1..219 | 1130 | 100 | Plus |
Gnpnat-PH | 215 | CG1969-PH | 2..215 | 6..219 | 1107 | 100 | Plus |
Gnpnat-PG | 215 | CG1969-PG | 2..215 | 6..219 | 1107 | 100 | Plus |
Gnpnat-PB | 215 | CG1969-PB | 2..215 | 6..219 | 1107 | 100 | Plus |
Gnpnat-PF | 228 | CG1969-PF | 2..215 | 6..219 | 1107 | 100 | Plus |
Gnpnat-PD | 225 | CG1969-PD | 1..214 | 1..214 | 1099 | 99.5 | Plus |
Gnpnat-PE | 221 | CG1969-PE | 2..209 | 6..213 | 1079 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10420-PA | 219 | GI10420-PA | 1..219 | 1..219 | 1032 | 88.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13913-PA | 222 | GL13913-PA | 1..222 | 1..219 | 1041 | 91.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15162-PA | 222 | GA15162-PA | 1..222 | 1..219 | 1041 | 91.4 | Plus |
Dpse\GA15162-PB | 218 | GA15162-PB | 2..218 | 6..219 | 1029 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12815-PA | 219 | GM12815-PA | 1..219 | 1..219 | 1165 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21459-PA | 219 | GD21459-PA | 1..219 | 1..219 | 1165 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10636-PA | 217 | GJ10636-PA | 1..217 | 1..219 | 1018 | 85.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11919-PA | 219 | GK11919-PA | 1..219 | 1..219 | 1046 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23878-PA | 219 | GE23878-PA | 1..219 | 1..219 | 1173 | 100 | Plus |
Translation from 35 to 694
> LD40766.hyp MVQLTEETYLYDPNLLLKLDFHRSPANFKPFISAANPGEPWMKVRPLKDT DYDRGFLQLLSQLTHVGNVNRTQFLTRFSQMKASGDYFVTVIEDTRKNEI IGAASLVIERKFIHNCAVRGRLEDVVVNDTYRGKQLGKLIVVTVSLLAEE LGCYKMSLDCKDKLIKFYESLGYVAIPGNSNSMTIRYDEGPTLKRNATSA GSSGTVGDSCQTVSLDFAS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG1969-PA | 219 | CG1969-PA | 1..219 | 1..219 | 1130 | 100 | Plus |
CG1969-PH | 215 | CG1969-PH | 2..215 | 6..219 | 1107 | 100 | Plus |
CG1969-PG | 215 | CG1969-PG | 2..215 | 6..219 | 1107 | 100 | Plus |
CG1969-PB | 215 | CG1969-PB | 2..215 | 6..219 | 1107 | 100 | Plus |
CG1969-PF | 228 | CG1969-PF | 2..215 | 6..219 | 1107 | 100 | Plus |