Clone LD40766 Report

Search the DGRC for LD40766

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:407
Well:66
Vector:pOT2
Associated Gene/TranscriptCG1969-RA
Protein status:LD40766.pep: gold
Preliminary Size:1409
Sequenced Size:1226

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1969 2001-01-01 Release 2 assignment
CG1969 2001-09-19 Blastp of sequenced clone
CG1969 2008-04-29 Release 5.5 accounting
CG1969 2008-08-15 Release 5.9 accounting
CG1969 2008-12-18 5.12 accounting

Clone Sequence Records

LD40766.complete Sequence

1226 bp (1226 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058687

> LD40766.complete
GCGTCACTTGCTGACGTGTGAAGTCCACTGCGAAAATGGTGCAACTTACG
GAGGAGACATATCTGTACGATCCTAATCTGCTGCTAAAGCTGGACTTTCA
TCGCAGTCCCGCCAACTTTAAGCCCTTCATATCGGCGGCCAATCCCGGCG
AGCCCTGGATGAAAGTGCGTCCTCTCAAGGACACCGACTACGATCGTGGA
TTCCTGCAGCTGCTCTCGCAACTCACCCATGTCGGCAATGTGAATCGTAC
GCAGTTCTTGACCCGCTTTTCGCAGATGAAAGCCAGTGGGGACTACTTTG
TCACCGTCATTGAGGACACTCGCAAGAATGAGATTATTGGAGCTGCATCC
TTGGTGATCGAGCGCAAGTTCATCCATAACTGTGCTGTGCGTGGCCGTCT
AGAGGATGTGGTGGTCAATGACACGTATCGCGGGAAGCAACTGGGAAAAC
TGATCGTGGTCACCGTATCGCTGCTGGCCGAGGAACTGGGCTGCTACAAA
ATGTCGCTGGACTGCAAGGACAAGCTGATCAAGTTCTATGAGTCGCTGGG
CTATGTGGCCATTCCCGGAAACTCCAACTCCATGACGATTCGCTACGATG
AGGGGCCAACGCTCAAGCGGAATGCTACCTCAGCCGGCTCCAGTGGAACA
GTGGGCGACTCCTGCCAAACTGTGAGCCTCGATTTTGCCTCTTGACAATT
AGCCGCCAACGCTGCTCCAAAGTCCAAGCTTTGAGTGGGAGCACCCCATC
TCAAAGTTACAAATGCGCGAAGCGCAATGCAACAAAACTAAAATTGGATT
CTAAGAAAACATTAAATGCATATAGGCATTGCCAAAATTCCATTGCGCTG
AGGGCATGATGGATTTTTGGACAGCGCTGGCTGGCGGTGGTGTCCTTGTG
GACGGACGTGCTTGTCCACCCACCCGCGAGGACATACAATTAGATATTTA
GTTAAAGACAACCGCAACATATGTTGCTCTCTGTTTTTAATCCCTACAGA
ACTCTCAATTTTATAATTTTTTCTCCCCTTTCTGCTACTGAATGTGCGGC
TCGACCTCTCAACTCCAAGGTGGTTGTAATATTACCTTTTAAGAGCACCT
TCATCAAGTAGCCCTAAGATTGAAACACTCGCATAACTGTTAAACTGTTA
TTAACACTAATCAACAATAGCGATTAAAACCCAATACGAATCTTTCAAAA
ACCTTTAAAAAAAAAAAAAAAAAAAA

LD40766.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG1969-RA 1364 CG1969-RA 111..1318 1..1208 6040 100 Plus
CG1969.d 1252 CG1969.d 69..1227 50..1208 5795 100 Plus
CG1969.i 2970 CG1969.i 1766..2924 50..1208 5795 100 Plus
CG1969.d 1252 CG1969.d 32..70 1..39 195 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25563752..25564506 452..1206 3640 98.8 Plus
chr3R 27901430 chr3R 25563169..25563380 50..261 1030 99.1 Plus
chr3R 27901430 chr3R 25563442..25563569 262..389 580 96.9 Plus
chr3R 27901430 chr3R 25563630..25563693 389..452 305 98.4 Plus
chr3R 27901430 chr3R 25562972..25563022 1..51 255 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:35:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29741150..29741906 452..1208 3785 100 Plus
3R 32079331 3R 29740567..29740778 50..261 1060 100 Plus
3R 32079331 3R 29740840..29740967 262..389 640 100 Plus
3R 32079331 3R 29741028..29741091 389..452 320 100 Plus
3R 32079331 3R 29740370..29740420 1..51 255 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29481981..29482737 452..1208 3785 100 Plus
3R 31820162 3R 29481398..29481609 50..261 1060 100 Plus
3R 31820162 3R 29481671..29481798 262..389 640 100 Plus
3R 31820162 3R 29481859..29481922 389..452 320 100 Plus
3R 31820162 3R 29481201..29481251 1..51 255 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:00:39 has no hits.

LD40766.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:01:21 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25563442..25563569 262..389 96 -> Plus
chr3R 25563631..25563692 390..451 98 -> Plus
chr3R 25562972..25563021 1..50 100 -> Plus
chr3R 25563170..25563380 51..261 99 -> Plus
chr3R 25563752..25564506 452..1206 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:23:08 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RA 1..660 36..695 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:59:38 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RA 1..660 36..695 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:44:06 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RF 1..687 48..734 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:30:02 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RA 1..660 36..695 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:23:52 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RF 1..687 48..734 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:46:48 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RA 1..1206 1..1206 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:59:37 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RA 17..1222 1..1206 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:44:06 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RA 20..1225 1..1206 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:30:02 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RA 1..1206 1..1206 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:23:52 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RA 20..1225 1..1206 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:01:21 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29740370..29740419 1..50 100 -> Plus
3R 29740568..29740778 51..261 100 -> Plus
3R 29740840..29740967 262..389 100 -> Plus
3R 29741029..29741090 390..451 100 -> Plus
3R 29741150..29741904 452..1206 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:01:21 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29740370..29740419 1..50 100 -> Plus
3R 29740568..29740778 51..261 100 -> Plus
3R 29740840..29740967 262..389 100 -> Plus
3R 29741029..29741090 390..451 100 -> Plus
3R 29741150..29741904 452..1206 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:01:21 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29740370..29740419 1..50 100 -> Plus
3R 29740568..29740778 51..261 100 -> Plus
3R 29740840..29740967 262..389 100 -> Plus
3R 29741029..29741090 390..451 100 -> Plus
3R 29741150..29741904 452..1206 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:44:06 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25566092..25566141 1..50 100 -> Plus
arm_3R 25566290..25566500 51..261 100 -> Plus
arm_3R 25566562..25566689 262..389 100 -> Plus
arm_3R 25566751..25566812 390..451 100 -> Plus
arm_3R 25566872..25567626 452..1206 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:06:22 Download gff for LD40766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29481671..29481798 262..389 100 -> Plus
3R 29481860..29481921 390..451 100 -> Plus
3R 29481399..29481609 51..261 100 -> Plus
3R 29481981..29482735 452..1206 100   Plus
3R 29481201..29481250 1..50 100 -> Plus

LD40766.pep Sequence

Translation from 35 to 694

> LD40766.pep
MVQLTEETYLYDPNLLLKLDFHRSPANFKPFISAANPGEPWMKVRPLKDT
DYDRGFLQLLSQLTHVGNVNRTQFLTRFSQMKASGDYFVTVIEDTRKNEI
IGAASLVIERKFIHNCAVRGRLEDVVVNDTYRGKQLGKLIVVTVSLLAEE
LGCYKMSLDCKDKLIKFYESLGYVAIPGNSNSMTIRYDEGPTLKRNATSA
GSSGTVGDSCQTVSLDFAS*

LD40766.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23369-PA 219 GF23369-PA 1..219 1..219 1137 96.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11689-PA 219 GG11689-PA 1..219 1..219 1169 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14324-PA 219 GH14324-PA 1..219 1..219 1024 87.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
Gnpnat-PA 219 CG1969-PA 1..219 1..219 1130 100 Plus
Gnpnat-PH 215 CG1969-PH 2..215 6..219 1107 100 Plus
Gnpnat-PG 215 CG1969-PG 2..215 6..219 1107 100 Plus
Gnpnat-PB 215 CG1969-PB 2..215 6..219 1107 100 Plus
Gnpnat-PF 228 CG1969-PF 2..215 6..219 1107 100 Plus
Gnpnat-PD 225 CG1969-PD 1..214 1..214 1099 99.5 Plus
Gnpnat-PE 221 CG1969-PE 2..209 6..213 1079 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:36:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10420-PA 219 GI10420-PA 1..219 1..219 1032 88.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:36:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13913-PA 222 GL13913-PA 1..222 1..219 1041 91.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15162-PA 222 GA15162-PA 1..222 1..219 1041 91.4 Plus
Dpse\GA15162-PB 218 GA15162-PB 2..218 6..219 1029 92.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12815-PA 219 GM12815-PA 1..219 1..219 1165 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21459-PA 219 GD21459-PA 1..219 1..219 1165 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:36:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10636-PA 217 GJ10636-PA 1..217 1..219 1018 85.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:36:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11919-PA 219 GK11919-PA 1..219 1..219 1046 90 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:36:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23878-PA 219 GE23878-PA 1..219 1..219 1173 100 Plus

LD40766.hyp Sequence

Translation from 35 to 694

> LD40766.hyp
MVQLTEETYLYDPNLLLKLDFHRSPANFKPFISAANPGEPWMKVRPLKDT
DYDRGFLQLLSQLTHVGNVNRTQFLTRFSQMKASGDYFVTVIEDTRKNEI
IGAASLVIERKFIHNCAVRGRLEDVVVNDTYRGKQLGKLIVVTVSLLAEE
LGCYKMSLDCKDKLIKFYESLGYVAIPGNSNSMTIRYDEGPTLKRNATSA
GSSGTVGDSCQTVSLDFAS*

LD40766.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG1969-PA 219 CG1969-PA 1..219 1..219 1130 100 Plus
CG1969-PH 215 CG1969-PH 2..215 6..219 1107 100 Plus
CG1969-PG 215 CG1969-PG 2..215 6..219 1107 100 Plus
CG1969-PB 215 CG1969-PB 2..215 6..219 1107 100 Plus
CG1969-PF 228 CG1969-PF 2..215 6..219 1107 100 Plus