Clone LD40776 Report

Search the DGRC for LD40776

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:407
Well:76
Vector:pOT2
Associated Gene/TranscriptRae1-RA
Protein status:LD40776.pep: gold
Preliminary Size:1328
Sequenced Size:1201

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9862 2001-01-01 Release 2 assignment
CG9862 2003-01-01 Sim4 clustering to Release 3
CG9862 2003-01-15 Blastp of sequenced clone
Rae1 2008-04-29 Release 5.5 accounting
Rae1 2008-08-15 Release 5.9 accounting
Rae1 2008-12-18 5.12 accounting

Clone Sequence Records

LD40776.complete Sequence

1201 bp (1201 high quality bases) assembled on 2003-01-15

GenBank Submission: AY118568

> LD40776.complete
AAATAATACAAACACAAACATTTTGCGGCAACAAAAGCAGAAGAATGTTT
GGCGCCACACAATCGACGAACCGAATGAACGACTTCGAGGTCGCCTCGCC
GCCGGACGACTCCGTCTCGGCGCTGGAGTTCAGCCCCAGCACGGTGCAGA
AGAACTTCCTGGTGGCCGGAAGCTGGGACAGCACGGTCCGCTGCTGGGAG
GTGGAACAAAACGGGGCCACTGTGCCCAAGTCGATGAAGACCATGGGCGG
ACCGGTGCTGGACGTTTGCTGGTCGGACGACGGCAGCAAAGTGTTCGTCG
CCTCCTGCGACAAGCAGGTGAAGCTCTGGGACCTCGCCTCCGATCAAGTG
ATGCAAGTGGCGGCCCACGACGGTCCCGTTAAGACGTGCCACATGGTCAA
GGGACCCACGTACACCTGCCTCATGACCGGCTCCTGGGACAAGACCCTAA
AGTTCTGGGACACCCGTTCGCCCAATCCCATGATGACCATCAATCTACCC
GAGCGGTGCTACTGCGCCGATGTGGAGTATCCGATGGCCGTGGTGGGCAC
GGCCAACAGAGGACTCATCATATACTCGCTGCAGAATAGCCCAACCGAGT
ACAAGCGGCAGGAGAGTCCGCTGAAGTACCAGCACCGTGCCATTTCCATT
TTCCGGGACAAGAAAAAAGAGCCCACAGGCTGTGCGCTGGGCAGCATTGA
GGGCCGTGTGGCCATTCAGTATGTGAATCCGGGGAATCCAAAAGATAACT
TCACCTTCAAGTGCCACCGTACTACGGGCACCTCAGGCTACCAGGATATT
TATGCAGTAAATGACATCGCATTCCACCCTGTGCACGGCACCCTGGTGAC
CGTTGGCTCAGATGGCACCTTCAGTTTCTGGGACAAGGATGCCCGGACCA
AGCTCAAGTCCAGCGAGACCATGGATCAGTCCATTACCAAATGCGGATTT
AACGCCAACGGCCAGATATTTGCGTACGCCGTCGGCTACGACTGGTCGAA
GGGCCACGAGTACTTCAACCCGGCCAAGAAGCCCCAAATCTTTCTGCGCT
CGTGCTACGACGAGCTCAAGCCGCGCATTAACTGATCGGAGGACTACTTT
AGCTTTAGTGAAAACCCCTACGCGTACATGTATTGCGAATAAAGTGAATT
GGAGCGATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
A

LD40776.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
Rae1-RA 1362 Rae1-RA 136..1294 1..1159 5795 100 Plus
CG10320-RD 622 CG10320-RD 542..622 1159..1079 405 100 Minus
CG10320-RA 683 CG10320-RA 603..683 1159..1079 405 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17545215..17545922 1158..451 3495 99.6 Minus
chr2R 21145070 chr2R 17545970..17546421 452..1 2260 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:35:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21658769..21659477 1159..451 3545 100 Minus
2R 25286936 2R 21659525..21659976 452..1 2260 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21659968..21660676 1159..451 3545 100 Minus
2R 25260384 2R 21660724..21661175 452..1 2260 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:29:46 has no hits.

LD40776.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:30:27 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17545215..17545920 453..1158 99 <- Minus
chr2R 17545970..17546421 1..452 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:23:09 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
Rae1-RA 1..1041 45..1085 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:52 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
Rae1-RA 1..1041 45..1085 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:22:32 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
Rae1-RA 1..1041 45..1085 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:51 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
Rae1-RA 1..1041 45..1085 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:25:14 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
Rae1-RA 1..1041 45..1085 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:11:23 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
Rae1-RA 28..1185 1..1158 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:52 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
Rae1-RA 28..1185 1..1158 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:22:32 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
Rae1-RA 32..1189 1..1158 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:51 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
Rae1-RA 28..1185 1..1158 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:25:14 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
Rae1-RA 32..1189 1..1158 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:30:27 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21658770..21659475 453..1158 100 <- Minus
2R 21659525..21659976 1..452 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:30:27 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21658770..21659475 453..1158 100 <- Minus
2R 21659525..21659976 1..452 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:30:27 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21658770..21659475 453..1158 100 <- Minus
2R 21659525..21659976 1..452 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:22:32 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17546275..17546980 453..1158 100 <- Minus
arm_2R 17547030..17547481 1..452 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:01 Download gff for LD40776.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21659969..21660674 453..1158 100 <- Minus
2R 21660724..21661175 1..452 100   Minus

LD40776.hyp Sequence

Translation from 2 to 1084

> LD40776.hyp
IIQTQTFCGNKSRRMFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQK
NFLVAGSWDSTVRCWEVEQNGATVPKSMKTMGGPVLDVCWSDDGSKVFVA
SCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKGPTYTCLMTGSWDKTLK
FWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQNSPTEY
KRQESPLKYQHRAISIFRDKKKEPTGCALGSIEGRVAIQYVNPGNPKDNF
TFKCHRTTGTSGYQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTK
LKSSETMDQSITKCGFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRS
CYDELKPRIN*

LD40776.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
Rae1-PA 346 CG9862-PA 1..346 15..360 1884 100 Plus
CG12782-PA 336 CG12782-PA 4..328 16..349 675 41.6 Plus
Bub3-PB 326 CG7581-PB 2..297 24..329 401 32.4 Plus
Bub3-PA 326 CG7581-PA 2..297 24..329 401 32.4 Plus

LD40776.pep Sequence

Translation from 44 to 1084

> LD40776.pep
MFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRC
WEVEQNGATVPKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASD
QVMQVAAHDGPVKTCHMVKGPTYTCLMTGSWDKTLKFWDTRSPNPMMTIN
LPERCYCADVEYPMAVVGTANRGLIIYSLQNSPTEYKRQESPLKYQHRAI
SIFRDKKKEPTGCALGSIEGRVAIQYVNPGNPKDNFTFKCHRTTGTSGYQ
DIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKC
GFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN*

LD40776.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11632-PA 336 GF11632-PA 1..336 11..346 1760 94.3 Plus
Dana\GF13306-PA 373 GF13306-PA 23..362 9..343 714 42.1 Plus
Dana\GF22876-PA 326 GF22876-PA 5..297 13..315 412 32.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20758-PA 346 GG20758-PA 1..346 1..346 1870 98.8 Plus
Dere\GG20054-PA 335 GG20054-PA 11..330 10..335 689 42.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23041-PA 347 GH23041-PA 1..347 1..346 1746 90.8 Plus
Dgri\GH18686-PA 326 GH18686-PA 4..316 12..335 395 30.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
Rae1-PA 346 CG9862-PA 1..346 1..346 1884 100 Plus
CG12782-PA 336 CG12782-PA 4..328 2..335 675 41.6 Plus
Bub3-PB 326 CG7581-PB 2..297 10..315 401 32.4 Plus
Bub3-PA 326 CG7581-PA 2..297 10..315 401 32.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21110-PA 349 GI21110-PA 1..349 1..346 1757 92.3 Plus
Dmoj\GI24196-PA 326 GI24196-PA 4..297 12..315 399 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11275-PA 347 GL11275-PA 1..347 1..346 1766 92.2 Plus
Dper\GL26269-PA 255 GL26269-PA 16..189 14..181 419 47.7 Plus
Dper\GL13583-PA 326 GL13583-PA 5..297 13..315 404 33.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22080-PA 347 GA22080-PA 1..347 1..346 1766 92.2 Plus
Dpse\GA20454-PA 326 GA20454-PA 5..297 13..315 404 33.2 Plus
Dpse\GA28102-PA 214 GA28102-PA 19..193 9..168 319 39.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15702-PA 346 GM15702-PA 1..346 1..346 1885 100 Plus
Dsec\GM15568-PA 336 GM15568-PA 11..328 10..335 672 41.7 Plus
Dsec\GM12232-PA 326 GM12232-PA 5..297 13..315 416 32.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25180-PA 173 GD25180-PA 1..167 1..167 901 100 Plus
Dsim\GD25070-PA 336 GD25070-PA 11..328 10..335 673 41.7 Plus
Dsim\GD17697-PA 326 GD17697-PA 5..297 13..315 416 32.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20959-PA 349 GJ20959-PA 1..349 1..346 1757 92.3 Plus
Dvir\GJ20971-PA 333 GJ20971-PA 7..333 13..344 1002 54.8 Plus
Dvir\GJ10544-PA 326 GJ10544-PA 4..297 12..315 404 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19577-PA 348 GK19577-PA 1..348 1..346 1760 92.2 Plus
Dwil\GK11174-PA 326 GK11174-PA 5..297 13..315 391 32.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13690-PA 346 GE13690-PA 1..346 1..346 1870 98.8 Plus
Dyak\GE11590-PA 337 GE11590-PA 10..335 9..335 681 42 Plus
Dyak\GE10441-PA 326 GE10441-PA 5..297 13..315 414 32.7 Plus