Clone LD40777 Report

Search the DGRC for LD40777

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:407
Well:77
Vector:pOT2
Associated Gene/TranscriptPCID2-RA
Protein status:LD40777.pep: gold
Preliminary Size:1492
Sequenced Size:1314

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7351 2001-01-01 Release 2 assignment
CG7351 2001-09-19 Blastp of sequenced clone
CG7351 2003-01-01 Sim4 clustering to Release 3
CG7351 2008-04-29 Release 5.5 accounting
CG7351 2008-08-15 Release 5.9 accounting
CG7351 2008-12-18 5.12 accounting

Clone Sequence Records

LD40777.complete Sequence

1314 bp (1314 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058688

> LD40777.complete
CTACCATCTCTAATTTTGCCGCCTGCGAAAAACACAAACAATGTTCGGCA
CCGTAAATAACTATTTATCCGGCGTTTTGCACGCCGCCCAGGATTTAGAT
GGCGAGTCCTTGGCCACGTATCTCTCCTTACGAGACGTGCACGTTCAGAA
CCACAATTTGTACATTGCCCAGCCGGAAAAGTTGGTGGATCGATTCCTGA
AACCGCCACTGGACGAAGTTGTGTCCGCCCACCTGAAGGTGCTGTATCAC
CTGGCACAGGAGCCTCCTGGTTACATGGAAGCCTACACCCAACAGTCGGC
AGCCTGCGGAGCCGTTGTGAGGCTTTTGCAGCAGCTGAAGGACGAGAATT
GGTGCCTGCCACTAATGTACCGCGTGTGCCTGGATCTAAGGTACTTGGCG
CAGGCCTGCGAGAAGCATTGTCAAGGATTCACACCTGGCCACGTATTGGA
GAAGGCTGCCGACTGCATAATGGCCTGTTTCCGCGTTTGTGCCGCTGATG
GACGAGCTTCAGAGGAGGACACCAAGCGTCTGGGCATGATGAACCTCGTA
AACCAGCTATTCAAGATTTATTTTCGAATCAACAAGTTGCATCTGTGCAA
GCCCCTTATCCGTGCCATCGATAATTGCATCTTCAAGGATTCTTTTCCGC
TGCCGGAGCAAATTACCTACAAGTATTTTGTAGGTAGACGGGCTATGTTC
GACTCCAACTACCAGGCAGCCGTACAGTATCTGTCGTATGCCTTTAGCAA
CTGCCCGGATCGGTTTGCCAGCAACAAGAGGCTCATCCTCATCTATTTGG
TGCCAGTGAAGATGCTGCTGGGATATCTGCCCAGCAAATCCTTACTGCAG
CGCTACGATCTCCTGCTGTTTCTCGATCTGGCTATGGCCATGAAGGCTGG
CAATGTGAATCGCTTTGATGAGATTGTCAGGGACCAGGAGCTGGTGCTGA
TCAGGAGTGGTATCTATCTGCTGGTGGAGAAGCTCAAGTTCCTCGTGTAT
CGCAACCTGTTCAAGAAGGTGTTCGTCATCCGGAAATCGCATCAGTTGGA
CATGGGTGACTTCCTCTCCGCCTTGCATTTCGTTGGCTTAACCGATGTTT
CTCTGGACGAGACGCACTGCATCGTGGCCAATCTCATTTACGATGGAAAG
ATTAAGGGGTACATCTCACATGCTCACAACAAACTGGTCGTGTCGAAGCA
AAATCCATTCCCCTCAGTGTCCCTTTAGTGCATTTTGTAATTATTGTGAA
TTTTTAAGAGTAAAAGAATCCAATTTAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA

LD40777.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
PCID2-RA 1281 PCID2-RA 1..1278 1..1278 6390 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11617346..11618621 1..1276 6320 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:35:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11626440..11627717 1..1278 6390 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11619540..11620817 1..1278 6390 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:32:17 has no hits.

LD40777.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:33:10 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11617346..11618621 1..1276 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:23:10 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
CG7351-RA 1..1188 41..1228 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:59:39 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
PCID2-RA 1..1188 41..1228 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:07:19 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
PCID2-RA 1..1188 41..1228 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:30:03 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
CG7351-RA 1..1188 41..1228 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:36:10 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
PCID2-RA 1..1188 41..1228 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:46:49 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
CG7351-RA 1..1276 1..1276 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:59:39 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
PCID2-RA 1..1276 1..1276 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:07:19 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
PCID2-RA 1..1275 2..1276 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:30:03 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
CG7351-RA 1..1276 1..1276 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:36:10 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
PCID2-RA 1..1275 2..1276 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:33:10 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11626440..11627715 1..1276 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:33:10 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11626440..11627715 1..1276 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:33:10 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11626440..11627715 1..1276 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:07:19 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11619540..11620815 1..1276 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:06:24 Download gff for LD40777.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11619540..11620815 1..1276 100   Plus

LD40777.pep Sequence

Translation from 40 to 1227

> LD40777.pep
MFGTVNNYLSGVLHAAQDLDGESLATYLSLRDVHVQNHNLYIAQPEKLVD
RFLKPPLDEVVSAHLKVLYHLAQEPPGYMEAYTQQSAACGAVVRLLQQLK
DENWCLPLMYRVCLDLRYLAQACEKHCQGFTPGHVLEKAADCIMACFRVC
AADGRASEEDTKRLGMMNLVNQLFKIYFRINKLHLCKPLIRAIDNCIFKD
SFPLPEQITYKYFVGRRAMFDSNYQAAVQYLSYAFSNCPDRFASNKRLIL
IYLVPVKMLLGYLPSKSLLQRYDLLLFLDLAMAMKAGNVNRFDEIVRDQE
LVLIRSGIYLLVEKLKFLVYRNLFKKVFVIRKSHQLDMGDFLSALHFVGL
TDVSLDETHCIVANLIYDGKIKGYISHAHNKLVVSKQNPFPSVSL*

LD40777.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25277-PA 396 GF25277-PA 1..393 1..393 1908 88.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15516-PA 395 GG15516-PA 1..395 1..395 2017 94.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14860-PA 396 GH14860-PA 1..393 1..393 1859 86.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
PCID2-PA 395 CG7351-PA 1..395 1..395 2060 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13711-PA 396 GI13711-PA 1..393 1..393 1868 86.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16271-PA 396 GL16271-PA 1..391 1..391 1727 80.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20286-PA 396 GA20286-PA 1..391 1..391 1727 80.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25285-PA 395 GM25285-PA 1..395 1..395 2063 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14316-PA 395 GD14316-PA 1..395 1..395 2063 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14053-PA 396 GJ14053-PA 1..393 1..393 1880 87.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17175-PA 397 GK17175-PA 1..392 1..391 1828 85.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21831-PA 395 GE21831-PA 1..395 1..395 2026 95.7 Plus

LD40777.hyp Sequence

Translation from 40 to 1227

> LD40777.hyp
MFGTVNNYLSGVLHAAQDLDGESLATYLSLRDVHVQNHNLYIAQPEKLVD
RFLKPPLDEVVSAHLKVLYHLAQEPPGYMEAYTQQSAACGAVVRLLQQLK
DENWCLPLMYRVCLDLRYLAQACEKHCQGFTPGHVLEKAADCIMACFRVC
AADGRASEEDTKRLGMMNLVNQLFKIYFRINKLHLCKPLIRAIDNCIFKD
SFPLPEQITYKYFVGRRAMFDSNYQAAVQYLSYAFSNCPDRFASNKRLIL
IYLVPVKMLLGYLPSKSLLQRYDLLLFLDLAMAMKAGNVNRFDEIVRDQE
LVLIRSGIYLLVEKLKFLVYRNLFKKVFVIRKSHQLDMGDFLSALHFVGL
TDVSLDETHCIVANLIYDGKIKGYISHAHNKLVVSKQNPFPSVSL*

LD40777.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
PCID2-PA 395 CG7351-PA 1..395 1..395 2060 100 Plus