Clone LD41874 Report

Search the DGRC for LD41874

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:418
Well:74
Vector:pOT2
Associated Gene/TranscriptCG10237-RB
Protein status:LD41874.pep: gold
Preliminary Size:1645
Sequenced Size:1437

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10237 2001-01-01 Release 2 assignment
CG10237 2001-10-10 Blastp of sequenced clone
CG10237 2003-01-01 Sim4 clustering to Release 3
CG10237 2008-04-29 Release 5.5 accounting
CG10237 2008-08-15 Release 5.9 accounting
CG10237 2008-12-18 5.12 accounting

Clone Sequence Records

LD41874.complete Sequence

1437 bp (1437 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061463

> LD41874.complete
ATTTAGCCACCGCCGATGCTCCCGACTCGATCAGCCTGAATAAAGAAATA
TTAATTTATTTACATACGCTAGCATTTGCATGTGCATACCGGTTTAGTTA
GTTGTAAAGTAACTTGTGTGTGTATTCATTCGATCTGCATCGCCATGACC
ATGCTGACCACTGCATCTGCGATGAGGTGCCTGCCCTCTGAATTCCCACT
TGGAGTACCCACCATGCTGTCGGACATCGACCAACTGCCCACGCTCCAGG
TGGGCGACTACACGCTCCAGTTCGAGTTGGGCGAGCCGACTGCCCAGGGC
AAGGAGGTGGCCATCAAGGAGCTGCGCGAAACACCCGAGCGCCAGAAGGA
GGCCTCCAAGGAGCTGGCCCGTCTTCTAGAAGCGGAGACGGACTTGCTGT
ACCCCAAGGGAAACGAGGAGTGGCTGATCAGATACCTGCGGCCCTGCAAG
TATTACCCGGAAAGTGCCCGTGATCTGATTAAGCGGTACTACGCCTTCAA
GGTGAAGCACGCGGATGTGTACACCGACCTGAAGCCATCGAACGAGGCCA
ACATCTTCAAGCACAACATCCTTACCGTCTTCCCCAACCGAGATCAACTG
GGTCGTCGCATTTTGGTCCTCGAACTGGGCAAGCGCTGGAAGCACAAGCA
GGTCACCCTCGATGAGGTGTTCAAGGGAGCTGTGCTCTTCCTGGAGGCGG
CCATGCTGGAGCCAGAAACACAGATCTGCGGAGCCGTTGTGATCTTCGAC
ATGGATGGCCTCAGTCTCCAGCAAACGTGGCAGTTTACGCCTCCGTTCGC
CAAGCGCATTGTGGACTGGCTTCAGGACTCGGTGCCGCTCCGGATCAAGG
CCATTCACATCGTGAACCAGCCGAAGATTTTCCAGGTGGTCTTTGCCCTG
TTCAAGCCCTTCCTCAAGGAGAAGCTGCGCAGCAGGATCATCTTCCATGG
CACCGATCGCGAGTCCCTGCACAAATACATGTCGCCCAAGTGCCTGCCAG
CCGCCTACGGAGGATTCCGGGAGGCCAGCCGCATCGACAGCGACCAGTGG
TACCAGCTGCTGCTCAAGTGCGACACCGAGTTCGACACCATCAACTCGTA
CGGCTACAAGAAGAAGTGATCTGTGGCCACCGGCCTGGTGCTGCTCGTGA
TAATCAACTCCACTCGTTTCCACACGTCTTCACATTAAGCCCACGTGGAG
CGTTATAGTTAAGCACTCGATCTACCATACGCTTGTCCTGTTAGTGAGTA
GCGCCTAGAGTTTGCCTTAGTCTTAACCAGGATCGGAGTGTCGATCGCAG
CCAGAAGAAGTGTTATACCTACATGCATATTATTTTAATCCGGGGTAAGC
GTATTTATATCATTTTACTATTGTACATTAAACCAATTGTTAAAATATAA
ACATACTTTGTAAACAAAAAAAAAAAAAAAAAAAAAA

LD41874.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG10237-RB 1515 CG10237-RB 95..1512 1..1418 7090 100 Plus
CG10237.a 2022 CG10237.a 803..2019 202..1418 6085 100 Plus
CG10237-RA 1496 CG10237-RA 277..1493 202..1418 6085 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19434408..19435191 1415..632 3890 99.7 Minus
chr2L 23010047 chr2L 19439221..19439423 203..1 1015 100 Minus
chr2L 23010047 chr2L 19436224..19436404 382..202 905 100 Minus
chr2L 23010047 chr2L 19435368..19435522 631..477 775 100 Minus
chr2L 23010047 chr2L 19435590..19435686 477..381 485 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:36:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19435847..19436633 1418..632 3935 100 Minus
2L 23513712 2L 19440663..19440865 203..1 1015 100 Minus
2L 23513712 2L 19437666..19437846 382..202 905 100 Minus
2L 23513712 2L 19436810..19436964 631..477 775 100 Minus
2L 23513712 2L 19437032..19437128 477..381 485 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19435847..19436633 1418..632 3935 100 Minus
2L 23513712 2L 19440663..19440865 203..1 1015 100 Minus
2L 23513712 2L 19437666..19437846 382..202 905 100 Minus
2L 23513712 2L 19436810..19436964 631..477 775 100 Minus
2L 23513712 2L 19437032..19437128 477..381 485 100 Minus
Blast to na_te.dros performed 2019-03-16 11:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
flea 5034 flea DMBLPP 5034bp Derived from Z27119 (g415797) (Rel. 50, Last updated, Version 6). 4329..4389 1065..1124 122 68.9 Plus

LD41874.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:04:50 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19439222..19439423 1..202 100   Minus
chr2L 19434408..19435191 632..1415 99 <- Minus
chr2L 19435368..19435521 478..631 100 <- Minus
chr2L 19435590..19435684 383..477 100 <- Minus
chr2L 19436224..19436403 203..382 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:24:23 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RB 1..975 145..1119 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:53:33 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RB 1..975 145..1119 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:47:47 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RB 1..975 145..1119 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:22:33 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RB 1..975 145..1119 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:24:48 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RB 1..975 145..1119 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:38:45 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RB 1..1415 1..1415 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:53:33 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RB 1..1415 1..1415 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:47:47 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RB 43..1457 1..1415 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:22:33 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RB 1..1415 1..1415 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:24:48 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RB 43..1457 1..1415 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:04:50 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19435850..19436633 632..1415 100 <- Minus
2L 19436810..19436963 478..631 100 <- Minus
2L 19437032..19437126 383..477 100 <- Minus
2L 19437666..19437845 203..382 100 <- Minus
2L 19440664..19440865 1..202 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:04:50 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19435850..19436633 632..1415 100 <- Minus
2L 19436810..19436963 478..631 100 <- Minus
2L 19437032..19437126 383..477 100 <- Minus
2L 19437666..19437845 203..382 100 <- Minus
2L 19440664..19440865 1..202 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:04:50 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19435850..19436633 632..1415 100 <- Minus
2L 19436810..19436963 478..631 100 <- Minus
2L 19437032..19437126 383..477 100 <- Minus
2L 19437666..19437845 203..382 100 <- Minus
2L 19440664..19440865 1..202 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:47:47 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19440664..19440865 1..202 100   Minus
arm_2L 19437032..19437126 383..477 100 <- Minus
arm_2L 19437666..19437845 203..382 100 <- Minus
arm_2L 19435850..19436633 632..1415 100 <- Minus
arm_2L 19436810..19436963 478..631 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:59:39 Download gff for LD41874.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19435850..19436633 632..1415 100 <- Minus
2L 19436810..19436963 478..631 100 <- Minus
2L 19437032..19437126 383..477 100 <- Minus
2L 19437666..19437845 203..382 100 <- Minus
2L 19440664..19440865 1..202 100   Minus

LD41874.pep Sequence

Translation from 144 to 1118

> LD41874.pep
MTMLTTASAMRCLPSEFPLGVPTMLSDIDQLPTLQVGDYTLQFELGEPTA
QGKEVAIKELRETPERQKEASKELARLLEAETDLLYPKGNEEWLIRYLRP
CKYYPESARDLIKRYYAFKVKHADVYTDLKPSNEANIFKHNILTVFPNRD
QLGRRILVLELGKRWKHKQVTLDEVFKGAVLFLEAAMLEPETQICGAVVI
FDMDGLSLQQTWQFTPPFAKRIVDWLQDSVPLRIKAIHIVNQPKIFQVVF
ALFKPFLKEKLRSRIIFHGTDRESLHKYMSPKCLPAAYGGFREASRIDSD
QWYQLLLKCDTEFDTINSYGYKKK*

LD41874.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15843-PA 306 GF15843-PA 1..306 19..324 1490 89.5 Plus
Dana\GF15861-PA 311 GF15861-PA 10..303 27..321 605 41.6 Plus
Dana\GF14025-PA 294 GF14025-PA 6..278 36..308 502 39.4 Plus
Dana\GF14236-PA 290 GF14236-PA 54..258 88..293 395 35.4 Plus
Dana\GF24441-PA 310 GF24441-PA 12..285 53..324 260 25 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21633-PA 329 GG21633-PA 1..329 1..324 1653 94.5 Plus
Dere\GG10481-PA 311 GG10481-PA 10..303 27..321 594 41.2 Plus
Dere\GG23533-PA 294 GG23533-PA 6..276 36..306 490 38.2 Plus
Dere\GG21183-PA 292 GG21183-PA 24..258 58..293 405 33.5 Plus
Dere\GG15223-PA 311 GG15223-PA 9..252 49..290 282 30.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13468-PA 301 GH13468-PA 1..301 24..324 1410 86 Plus
Dgri\GH13736-PA 312 GH13736-PA 10..303 27..321 605 41.7 Plus
Dgri\GH13145-PA 294 GH13145-PA 7..287 37..320 485 37.2 Plus
Dgri\GH11102-PA 290 GH11102-PA 54..258 88..293 410 36.9 Plus
Dgri\GH15439-PA 324 GH15439-PA 23..265 50..290 260 27.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG10237-PB 324 CG10237-PB 1..324 1..324 1699 100 Plus
CG10237-PE 306 CG10237-PE 3..306 21..324 1596 100 Plus
CG10237-PC 306 CG10237-PC 3..306 21..324 1596 100 Plus
CG10237-PD 301 CG10237-PD 1..301 24..324 1580 100 Plus
CG10237-PA 301 CG10237-PA 1..301 24..324 1580 100 Plus
CG5973-PF 311 CG5973-PF 10..303 27..321 589 41 Plus
CG5973-PE 311 CG5973-PE 10..303 27..321 589 41 Plus
CG5973-PG 311 CG5973-PG 10..303 27..321 589 41 Plus
CG5973-PD 311 CG5973-PD 10..303 27..321 589 41 Plus
CG5973-PC 311 CG5973-PC 10..303 27..321 589 41 Plus
CG5973-PB 311 CG5973-PB 10..303 27..321 589 41 Plus
CG5973-PA 311 CG5973-PA 10..303 27..321 589 41 Plus
CG5958-PA 294 CG5958-PA 6..276 36..306 489 38.2 Plus
CG10026-PD 290 CG10026-PD 24..258 58..293 394 33.5 Plus
CG10026-PC 290 CG10026-PC 24..258 58..293 394 33.5 Plus
CG10026-PA 290 CG10026-PA 24..258 58..293 394 33.5 Plus
CG10026-PB 299 CG10026-PB 33..267 58..293 394 33.5 Plus
CG33514-PA 311 CG33514-PA 9..252 49..290 285 30.5 Plus
CG33966-PA 310 CG33966-PA 12..281 53..320 269 25 Plus
CG2663-PC 308 CG2663-PC 10..271 53..313 238 26.4 Plus
CG2663-PA 308 CG2663-PA 10..271 53..313 238 26.4 Plus
Cralbp-PA 324 CG10546-PA 17..253 54..290 233 26.4 Plus
CG12926-PA 313 CG12926-PA 23..288 59..324 223 27.1 Plus
CG10657-PA 334 CG10657-PA 21..273 37..290 222 27.1 Plus
CG33965-PA 317 CG33965-PA 17..290 53..324 208 22.7 Plus
CG31636-PB 313 CG31636-PB 12..251 53..290 200 24.5 Plus
CG31636-PA 313 CG31636-PA 12..251 53..290 200 24.5 Plus
CG10300-PA 311 CG10300-PA 49..284 90..324 168 23.1 Plus
CG3191-PC 309 CG3191-PC 32..263 68..290 157 22.7 Plus
CG3191-PA 309 CG3191-PA 32..263 68..290 157 22.7 Plus
CG3091-PC 303 CG3091-PC 48..261 94..290 151 22.2 Plus
CG3091-PA 303 CG3091-PA 48..261 94..290 151 22.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17220-PA 306 GI17220-PA 1..306 19..324 1407 83.7 Plus
Dmoj\GI23782-PA 312 GI23782-PA 10..272 27..290 598 43.9 Plus
Dmoj\GI17784-PA 294 GI17784-PA 1..287 31..320 503 36.1 Plus
Dmoj\GI18224-PA 290 GI18224-PA 28..258 62..293 420 35.3 Plus
Dmoj\GI16717-PA 308 GI16717-PA 9..280 49..315 267 28 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21107-PA 337 GL21107-PA 1..337 1..324 1515 84 Plus
Dper\GL25934-PA 294 GL25934-PA 6..278 36..308 498 38.3 Plus
Dper\GL25817-PA 331 GL25817-PA 10..323 27..321 491 34.8 Plus
Dper\GL21211-PA 340 GL21211-PA 74..308 58..293 409 33.9 Plus
Dper\GL16163-PA 311 GL16163-PA 16..282 56..320 271 26.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10180-PA 337 GA10180-PA 1..337 1..324 1515 84 Plus
Dpse\GA19271-PA 311 GA19271-PA 10..303 27..321 594 41.2 Plus
Dpse\GA19258-PA 294 GA19258-PA 6..278 36..308 498 38.3 Plus
Dpse\GA10016-PA 290 GA10016-PA 24..258 58..293 406 33.9 Plus
Dpse\GA28411-PA 311 GA28411-PA 16..282 56..320 271 26.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17010-PA 324 GM17010-PA 1..324 1..324 1725 99.1 Plus
Dsec\GM16464-PA 311 GM16464-PA 10..303 27..321 591 41.2 Plus
Dsec\GM13560-PA 294 GM13560-PA 6..272 36..302 485 38.8 Plus
Dsec\GM17350-PA 303 GM17350-PA 37..271 58..293 402 33.1 Plus
Dsec\GM14655-PA 311 GM14655-PA 9..252 49..290 278 30.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21760-PA 321 GD21760-PA 1..321 4..324 1703 99.1 Plus
Dsim\GD23473-PA 311 GD23473-PA 10..303 27..321 593 41.2 Plus
Dsim\GD22495-PA 294 GD22495-PA 6..276 36..306 492 38.6 Plus
Dsim\GD24208-PA 290 GD24208-PA 24..258 58..293 401 33.1 Plus
Dsim\GD13840-PA 311 GD13840-PA 9..252 49..290 285 30.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17977-PA 306 GJ17977-PA 1..306 19..324 1392 83.3 Plus
Dvir\GJ20969-PA 312 GJ20969-PA 39..303 56..321 574 43.1 Plus
Dvir\GJ17610-PA 294 GJ17610-PA 1..276 31..306 509 39 Plus
Dvir\GJ18131-PA 290 GJ18131-PA 19..258 60..293 420 35.7 Plus
Dvir\GJ12461-PA 308 GJ12461-PA 4..271 44..319 266 28.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18196-PA 306 GK18196-PA 1..306 19..324 1453 87.3 Plus
Dwil\GK24307-PA 312 GK24307-PA 10..303 27..321 595 41.2 Plus
Dwil\GK24724-PA 292 GK24724-PA 4..276 36..308 505 39.4 Plus
Dwil\GK24799-PA 290 GK24799-PA 24..258 58..293 411 33.1 Plus
Dwil\GK11682-PA 311 GK11682-PA 9..286 63..318 284 30 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12652-PA 329 GE12652-PA 1..329 1..324 1705 97.6 Plus
Dyak\GE14561-PA 311 GE14561-PA 10..303 27..321 591 40.9 Plus
Dyak\GE18359-PA 294 GE18359-PA 6..278 36..308 491 38.7 Plus
Dyak\GE13256-PA 291 GE13256-PA 24..257 58..293 395 33.9 Plus
Dyak\GE21443-PA 311 GE21443-PA 9..252 49..290 296 30.9 Plus

LD41874.hyp Sequence

Translation from 144 to 1118

> LD41874.hyp
MTMLTTASAMRCLPSEFPLGVPTMLSDIDQLPTLQVGDYTLQFELGEPTA
QGKEVAIKELRETPERQKEASKELARLLEAETDLLYPKGNEEWLIRYLRP
CKYYPESARDLIKRYYAFKVKHADVYTDLKPSNEANIFKHNILTVFPNRD
QLGRRILVLELGKRWKHKQVTLDEVFKGAVLFLEAAMLEPETQICGAVVI
FDMDGLSLQQTWQFTPPFAKRIVDWLQDSVPLRIKAIHIVNQPKIFQVVF
ALFKPFLKEKLRSRIIFHGTDRESLHKYMSPKCLPAAYGGFREASRIDSD
QWYQLLLKCDTEFDTINSYGYKKK*

LD41874.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG10237-PB 324 CG10237-PB 1..324 1..324 1699 100 Plus
CG10237-PE 306 CG10237-PE 3..306 21..324 1596 100 Plus
CG10237-PC 306 CG10237-PC 3..306 21..324 1596 100 Plus
CG10237-PD 301 CG10237-PD 1..301 24..324 1580 100 Plus
CG10237-PA 301 CG10237-PA 1..301 24..324 1580 100 Plus