Clone LD42063 Report

Search the DGRC for LD42063

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:420
Well:63
Vector:pOT2
Associated Gene/TranscriptCG1636-RA
Protein status:LD42063.pep: gold
Preliminary Size:1406
Sequenced Size:1323

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1636 2001-01-01 Release 2 assignment
CG1636 2001-07-04 Blastp of sequenced clone
CG1636 2003-01-01 Sim4 clustering to Release 3
CG1636 2008-04-29 Release 5.5 accounting
CG1636 2008-08-15 Release 5.9 accounting
CG1636 2008-12-18 5.12 accounting

Clone Sequence Records

LD42063.complete Sequence

1323 bp (1323 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051948

> LD42063.complete
TAGAAACGAAACAAATTCTCCCAATTTTCGGCTGAAAACGAGGAACACCA
ACTCGCGATTCTGGGGCGGCAGAACGGGAAATCCCGCCGAGGAGCAGCAT
GACCTCCATTCTGGACATGAAGGCCGGTCCGCCCGACTACTGGGCGGAGA
TCAGCAACTTCTTTCTGCCGCTGAAATACCTGATCACCAACGACCGCTTC
GATTCGATGGTGCGGGACATAGACCTCTATTACCTGATCAACGGGGTCTT
TTGGATATTCGTGGCGTTGTCTTGCGGCTACTACGCCTTCCAGCGGCTCT
TCCAGTTCTTTCTGAAGTCGTCGAGCATGAAGCACTTTCAGCGGAGGCTG
TTCGCCCGCGTCATTTGGAACATCGCCTTCTATGCGGCCAGCTGCCTGTT
CCTGCACTTCTACAACGAGTTCATGATCCTGCCGCAGCTGATGAAGAACC
AAGGACGCTACTCGCTCTTCTACTCCTCGGAGAACCTGATCTTCTATCGA
TCTCATCAGGCGGAAAAGTTTCAGTTCTACTCGATCTTCATTATCACGTT
CTACCTGCATGGGGCGTGGTTGGACTTCAAGGACGCTGACTTCCTGGAGG
TGGGCTCCAAGGGACTCTACCTGCTGTCCCTCGTCGCCATCGATGTTTAC
AGGTACGAAAACTACTTTGTGGGCCTGAATCTAACGGTGGGTCTGTACAG
CATACTCACCGAGGTGCTAGCCCTGTTGGTCCTGCCCAGCACCAATTCAC
ACCGGATCATCTACCAGGTTTTCCTCGGTCTGCGCATCATGGTGTGGGCG
TATGTGTTTGTCAACCTACTGCCCTTTAAGTACTTCATACCCACGCTGTT
CGCCAAGAACTTTAAGCTTTCCCTGAATGTGCCCATTTGGTTGTGGTACG
GCCTCTCCATTTGGAACTCGCCGGTGCTGCAATACTTCTACCATCAGATA
TATCACACAGCGCCGTCGGATTGTTCGGGCGAGGGATCGGCGGCTAAGTG
CATCCTGGTCAAGGACACCAGTGAGTTCCGGCACTACAAGACACTGAAGA
AGGCCTATTTGGAGGTAAAGCTGGCACACATTAGAACCACGTCCAATTCG
CTGCCCTCCGAAACCAGTTCGGCCTCGGCCAAAACCTTTCAGGCCATAAA
ATGCGTCATGATGCTTAAGCGCAAATTGAAGCGAATTCGCGAGGGACGTG
GCCATGAGCCGGAGGATGACAACGATGACCAGGCCATTGATACCTAATCG
CGTCCTACCGCACGGACGCAGCACACTTTTACACAGTAGAAAACCACATT
TCCTTAAAAAAAAAAAAAAAAAA

LD42063.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG1636.c 6747 CG1636.c 34..1354 1..1321 6545 99.6 Plus
CG1636-RA 1660 CG1636-RA 34..1354 1..1321 6545 99.6 Plus
CG1636.b 2368 CG1636.b 34..1354 1..1321 6545 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:04:32
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8166514..8167016 651..1153 2455 99.2 Plus
chrX 22417052 chrX 8166084..8166434 303..653 1740 99.7 Plus
chrX 22417052 chrX 8165257..8165561 1..305 1525 100 Plus
chrX 22417052 chrX 8167075..8167227 1153..1305 765 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:37:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8274707..8275209 651..1153 2515 100 Plus
X 23542271 X 8274277..8274627 303..653 1755 100 Plus
X 23542271 X 8273450..8273754 1..305 1525 100 Plus
X 23542271 X 8275268..8275436 1153..1321 785 97.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8282805..8283307 651..1153 2515 100 Plus
X 23527363 X 8282375..8282725 303..653 1755 100 Plus
X 23527363 X 8281548..8281852 1..305 1525 100 Plus
X 23527363 X 8283366..8283534 1153..1321 785 97.6 Plus
Blast to na_te.dros performed on 2019-03-16 20:04:30 has no hits.

LD42063.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:05:32 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8165257..8165561 1..305 100 -> Plus
chrX 8166087..8166433 306..652 99 -> Plus
chrX 8166516..8167015 653..1152 99 -> Plus
chrX 8167075..8167227 1153..1305 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:24:41 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
CG1636-RA 1..1149 99..1247 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:16:20 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
CG1636-RA 1..1149 99..1247 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:38:44 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
CG1636-RA 1..1149 99..1247 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:47:46 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
CG1636-RA 1..1149 99..1247 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:51:33 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
CG1636-RA 1..1149 99..1247 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:10:30 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
CG1636-RA 34..1338 1..1305 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:16:20 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
CG1636-RA 34..1338 1..1305 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:38:44 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
CG1636-RA 39..1343 1..1305 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:47:46 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
CG1636-RA 34..1338 1..1305 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:51:33 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
CG1636-RA 39..1343 1..1305 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:32 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
X 8273450..8273754 1..305 100 -> Plus
X 8274280..8274626 306..652 100 -> Plus
X 8274709..8275208 653..1152 100 -> Plus
X 8275268..8275420 1153..1305 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:32 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
X 8273450..8273754 1..305 100 -> Plus
X 8274280..8274626 306..652 100 -> Plus
X 8274709..8275208 653..1152 100 -> Plus
X 8275268..8275420 1153..1305 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:32 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
X 8273450..8273754 1..305 100 -> Plus
X 8274280..8274626 306..652 100 -> Plus
X 8274709..8275208 653..1152 100 -> Plus
X 8275268..8275420 1153..1305 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:38:44 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8168313..8168659 306..652 100 -> Plus
arm_X 8167483..8167787 1..305 100 -> Plus
arm_X 8168742..8169241 653..1152 100 -> Plus
arm_X 8169301..8169453 1153..1305 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:25:48 Download gff for LD42063.complete
Subject Subject Range Query Range Percent Splice Strand
X 8281548..8281852 1..305 100 -> Plus
X 8282378..8282724 306..652 100 -> Plus
X 8282807..8283306 653..1152 100 -> Plus
X 8283366..8283518 1153..1305 100   Plus

LD42063.pep Sequence

Translation from 98 to 1246

> LD42063.pep
MTSILDMKAGPPDYWAEISNFFLPLKYLITNDRFDSMVRDIDLYYLINGV
FWIFVALSCGYYAFQRLFQFFLKSSSMKHFQRRLFARVIWNIAFYAASCL
FLHFYNEFMILPQLMKNQGRYSLFYSSENLIFYRSHQAEKFQFYSIFIIT
FYLHGAWLDFKDADFLEVGSKGLYLLSLVAIDVYRYENYFVGLNLTVGLY
SILTEVLALLVLPSTNSHRIIYQVFLGLRIMVWAYVFVNLLPFKYFIPTL
FAKNFKLSLNVPIWLWYGLSIWNSPVLQYFYHQIYHTAPSDCSGEGSAAK
CILVKDTSEFRHYKTLKKAYLEVKLAHIRTTSNSLPSETSSASAKTFQAI
KCVMMLKRKLKRIREGRGHEPEDDNDDQAIDT*

LD42063.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22490-PA 383 GF22490-PA 1..383 1..382 1814 88.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19310-PA 382 GG19310-PA 1..382 1..382 2027 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12362-PA 380 GH12362-PA 2..380 3..382 1684 80.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG1636-PC 382 CG1636-PC 1..382 1..382 2017 100 Plus
CG1636-PA 382 CG1636-PA 1..382 1..382 2017 100 Plus
CG1636-PB 366 CG1636-PB 1..366 1..382 1904 95.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14734-PA 379 GI14734-PA 2..375 3..377 1665 80.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19814-PA 383 GL19814-PA 1..383 1..382 1772 86.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27232-PA 323 GA27232-PA 1..323 1..323 1528 87.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21496-PA 382 GM21496-PA 1..382 1..382 2038 99.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16892-PA 382 GD16892-PA 1..382 1..382 2038 99.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19146-PA 379 GJ19146-PA 2..379 3..381 1613 77.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16290-PA 381 GK16290-PA 1..377 1..377 1716 82.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:20:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15775-PA 382 GE15775-PA 1..382 1..382 2024 99 Plus

LD42063.hyp Sequence

Translation from 98 to 1246

> LD42063.hyp
MTSILDMKAGPPDYWAEISNFFLPLKYLITNDRFDSMVRDIDLYYLINGV
FWIFVALSCGYYAFQRLFQFFLKSSSMKHFQRRLFARVIWNIAFYAASCL
FLHFYNEFMILPQLMKNQGRYSLFYSSENLIFYRSHQAEKFQFYSIFIIT
FYLHGAWLDFKDADFLEVGSKGLYLLSLVAIDVYRYENYFVGLNLTVGLY
SILTEVLALLVLPSTNSHRIIYQVFLGLRIMVWAYVFVNLLPFKYFIPTL
FAKNFKLSLNVPIWLWYGLSIWNSPVLQYFYHQIYHTAPSDCSGEGSAAK
CILVKDTSEFRHYKTLKKAYLEVKLAHIRTTSNSLPSETSSASAKTFQAI
KCVMMLKRKLKRIREGRGHEPEDDNDDQAIDT*

LD42063.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG1636-PC 382 CG1636-PC 1..382 1..382 2017 100 Plus
CG1636-PA 382 CG1636-PA 1..382 1..382 2017 100 Plus
CG1636-PB 366 CG1636-PB 1..366 1..382 1904 95.8 Plus