Clone LD42119 Report

Search the DGRC for LD42119

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:421
Well:19
Vector:pOT2
Associated Gene/TranscriptSpase25-RA
Protein status:LD42119.pep: gold
Preliminary Size:988
Sequenced Size:805

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1751 2001-01-01 Release 2 assignment
CG1751 2002-03-19 Blastp of sequenced clone
CG1751 2003-01-01 Sim4 clustering to Release 3
Spase25 2008-04-29 Release 5.5 accounting
Spase25 2008-08-15 Release 5.9 accounting
Spase25 2008-12-18 5.12 accounting

Clone Sequence Records

LD42119.complete Sequence

805 bp (805 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094832

> LD42119.complete
ACAAAAACGAAGAAAACTCCTGAAAAAAGAAAAAAGAGTTTTTCTGAGCA
TTTCGCAAACTTCTCTTGGAAATCAAGGGCATCAAAACACAATAGAGAGC
AGATAGAAGATGGGCAAGAAGGATGAAAAGTCACAGCAAGGCGAGGAGCT
GGTGAAGGTCAACAAGTGGGATGGATCCGCAGTGAAGCACGCCCTCGATG
ATGCAGTGAAAACCTGCCTCCTTGGCGATCGTCCCCAGCTGAAGGAGCAA
TTCGGCCTGGTCAACACCCGTTTGGCCCTCTGCGCCCTCGCCGTTTCCGT
GGCTATAATGGCCCATGCTTGGGACTTCACCCACCCCTTCCCGGAATCCC
GTCCAGTGCTCCTCTTCAGTGTTTTGGCCTACTTTGCACTCCTCGGCATT
CTGACCCTGCACTCCAGTTTCCGCGAGAAGGGCACCTTTGCGGTGGCCCT
GCAGAAGGACAAGGAGCGGGAGCGCCTGTGGGAGGCCAGCTCCGATATGC
GCAAGTACGACGACAAGTACCTGCTGACCCTCAGTGTTCGCGACACGAAA
AATGGCAAGCGGCGCGAGCAGAGCAGCAACAAGTCGTGCGCCGCCTTCAT
CGATCAGAATGGCATCGTCCTGGACAACCTGGTGGCCAACGAGGTCAACC
GTCTGTTCAACGCCTTAGCTGCCGACAAGAAGAACGCTAGCAGCCTTTCT
TCTAATTAAACCAAATTCCCCACTTTTGTCTCATTAAATTGTACACTTTT
GTGCTTAACATAAATTGTCTGAATCTGATAGAAACTTAAAAAAAAAAAAA
AAAAA

LD42119.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Spase25-RA 1061 Spase25-RA 68..856 1..789 3945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11376756..11377362 147..753 3035 100 Plus
chrX 22417052 chrX 11376481..11376628 1..148 740 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:37:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11485559..11486165 147..753 3035 100 Plus
X 23542271 X 11485284..11485431 1..148 740 100 Plus
X 23542271 X 11486235..11486271 753..789 185 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11493657..11494263 147..753 3035 100 Plus
X 23527363 X 11493382..11493529 1..148 740 100 Plus
X 23527363 X 11494333..11494369 753..789 185 100 Plus
Blast to na_te.dros performed 2019-03-16 16:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
Bari2 1064 Bari2 1064bp Derived from AF541951 (Rel. 73, Last updated, Version 1). 354..423 761..696 134 70.4 Minus

LD42119.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:43:25 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11376481..11376628 1..148 100 -> Plus
chrX 11376758..11377362 149..753 100 -> Plus
chrX 11377433..11377466 754..787 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:24:45 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
Spase25-RA 1..600 110..709 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:01 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
Spase25-RA 1..600 110..709 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:42 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
Spase25-RA 1..600 110..709 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:32 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
Spase25-RA 1..600 110..709 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:38:14 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
Spase25-RA 1..600 110..709 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:06:36 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
Spase25-RA 33..819 1..787 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:01 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
Spase25-RA 33..819 1..787 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:42 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
Spase25-RA 35..821 1..787 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:32 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
Spase25-RA 33..819 1..787 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:38:14 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
Spase25-RA 35..821 1..787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:43:25 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
X 11485284..11485431 1..148 100 -> Plus
X 11485561..11486165 149..753 100 -> Plus
X 11486236..11486269 754..787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:43:25 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
X 11485284..11485431 1..148 100 -> Plus
X 11485561..11486165 149..753 100 -> Plus
X 11486236..11486269 754..787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:43:25 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
X 11485284..11485431 1..148 100 -> Plus
X 11485561..11486165 149..753 100 -> Plus
X 11486236..11486269 754..787 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:42 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11379317..11379464 1..148 100 -> Plus
arm_X 11379594..11380198 149..753 100 -> Plus
arm_X 11380269..11380302 754..787 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:11 Download gff for LD42119.complete
Subject Subject Range Query Range Percent Splice Strand
X 11493659..11494263 149..753 100 -> Plus
X 11494334..11494367 754..787 100   Plus
X 11493382..11493529 1..148 100 -> Plus

LD42119.pep Sequence

Translation from 109 to 708

> LD42119.pep
MGKKDEKSQQGEELVKVNKWDGSAVKHALDDAVKTCLLGDRPQLKEQFGL
VNTRLALCALAVSVAIMAHAWDFTHPFPESRPVLLFSVLAYFALLGILTL
HSSFREKGTFAVALQKDKERERLWEASSDMRKYDDKYLLTLSVRDTKNGK
RREQSSNKSCAAFIDQNGIVLDNLVANEVNRLFNALAADKKNASSLSSN*

LD42119.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:01:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23480-PA 193 GF23480-PA 1..192 1..192 940 89.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18424-PA 199 GG18424-PA 1..199 1..199 1010 96 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12372-PA 194 GH12372-PA 1..193 1..192 821 78.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
Spase25-PC 199 CG1751-PC 1..199 1..199 1012 100 Plus
Spase25-PB 199 CG1751-PB 1..199 1..199 1012 100 Plus
Spase25-PA 199 CG1751-PA 1..199 1..199 1012 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14750-PA 193 GI14750-PA 1..192 1..192 829 78.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19894-PA 185 GL19894-PA 1..184 1..192 794 77.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14534-PA 189 GA14534-PA 1..188 1..192 838 81.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13086-PA 199 GM13086-PA 1..199 1..199 1047 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19154-PA 193 GJ19154-PA 1..191 1..191 835 80.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10219-PA 189 GK10219-PA 1..188 1..192 816 79.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15941-PA 199 GE15941-PA 1..199 1..199 1020 97 Plus

LD42119.hyp Sequence

Translation from 109 to 708

> LD42119.hyp
MGKKDEKSQQGEELVKVNKWDGSAVKHALDDAVKTCLLGDRPQLKEQFGL
VNTRLALCALAVSVAIMAHAWDFTHPFPESRPVLLFSVLAYFALLGILTL
HSSFREKGTFAVALQKDKERERLWEASSDMRKYDDKYLLTLSVRDTKNGK
RREQSSNKSCAAFIDQNGIVLDNLVANEVNRLFNALAADKKNASSLSSN*

LD42119.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Spase25-PC 199 CG1751-PC 1..199 1..199 1012 100 Plus
Spase25-PB 199 CG1751-PB 1..199 1..199 1012 100 Plus
Spase25-PA 199 CG1751-PA 1..199 1..199 1012 100 Plus