Clone LD42595 Report

Search the DGRC for LD42595

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:425
Well:95
Vector:pOT2
Associated Gene/TranscriptCG8121-RA
Protein status:LD42595.pep: gold
Preliminary Size:1474
Sequenced Size:1261

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8121 2001-01-01 Release 2 assignment
CG8121 2001-07-04 Blastp of sequenced clone
CG8121 2003-01-01 Sim4 clustering to Release 3
CG8121 2008-04-29 Release 5.5 accounting
CG8121 2008-08-15 Release 5.9 accounting
CG8121 2008-12-18 5.12 accounting

Clone Sequence Records

LD42595.complete Sequence

1261 bp (1261 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051956

> LD42595.complete
ATTAATATTTCGTTTTTTTGGGTAGCTGATTAAAGGATTGATAAAGGACT
TGCCTTCTTATACACGTGACGAGACTTAAAAGGCTTCATGATGAATTACG
GTAGGAAAACGCCCTCCACATATCGGTCCAATCCGTCGGTTTATTCCCAT
GCCACGGGAAGATCCTCGACGAATTTACACTCCAAGATGTCCCGATCCAC
GCGATCCGTCAGGATTCCTTGGTACCAGCGACCGTTGCTTAAAAACAATC
AGTACATCGATATACAGAAGGGTGCCATGCTGGTCGGATTGTTTGCCATT
TTTCTGTCCCTCTTCACCATCGCCACGAGCATCTTTGACATCTACTGCTA
TGCTATGGCTGCGCCAGGATCCACACATTATGGCTACTACATCATATCCT
ATGAGTTCGTCTATGTGGGCAACAAGCATGTTCGCAATATGCTCATTGTC
TTTGCCCTGTTCTCGCTTATCATGGCGCTGATAAACTTTGTGACCAGTGT
CCTTCTCTGCGTGGCTCTGCGCAAGGAATACGAGAGGAAGGTTATGCCAT
GGCTGTGGTCCTTTGCCATATTTACTGTTTGGCGGGCTTTGGCACTGATC
TTCTTTGCCATTGTCAATGATCTGTACTTTGCCTACAATGTGATTATGGT
GCTCCTTTGGACCATTTTTTGTGTACTGTCTATATATGGATGGGCCGTGG
TGTACTCTCTGTTTTTGGAACTGGTGGATCTGACCAAGCTGGAGGATCTA
GCCCATTTACGCATGGGCACAATGGCTTCCCTGCACGCATCGACAGCAAA
CTCACTTGCAGGATCACGGCCAACCACTCCTCACAGCACCGTGTCCACCA
TGCCCGTGGGCTAATAAAAGTATTTGCCATCCATCTATGGGGCTCACAAC
GAAATTGCACAATCTAGACCGTCCGAATGCAGCTCAAGATAACCCTGATG
CTTCGCACTCAAACATTGCTTAAACTATAGTGTACATTCCATCCACCAGT
TTAGTGCCTTAGAGATGCGCCTCTCGAATACCACAAATTTTAACCGCGAA
TCAGCGTAATTAGTTGTAAGTCTATTCCGTCCAAACGCATATGTTTTTTG
TATACTGTTGAAGAATCGCTGTCTTTATGTATGAATGTCAAAATATCGTG
TTTTTTATATTCATATATAGATGTACAACCCGAATTGTAGCTATGTATCT
AAAATATTAAGCGACAAGCAATATAAAAAATACGAAACCGAAAAAAAAAA
AAAAAAAAAAA

LD42595.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG8121-RA 1546 CG8121-RA 63..1306 1..1244 6220 100 Plus
CG8121-RC 1617 CG8121-RC 130..1370 1..1244 6150 99.7 Plus
CG8121-RB 1655 CG8121-RB 342..1564 22..1244 6115 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5162543..5163020 763..1240 2390 100 Plus
chr3R 27901430 chr3R 5162245..5162483 524..762 1195 100 Plus
chr3R 27901430 chr3R 5161463..5161603 160..300 705 100 Plus
chr3R 27901430 chr3R 5161260..5161399 22..161 700 100 Plus
chr3R 27901430 chr3R 5161664..5161793 301..430 650 100 Plus
chr3R 27901430 chr3R 5161921..5162017 430..526 485 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:37:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9336779..9337260 763..1244 2410 100 Plus
3R 32079331 3R 9336481..9336719 524..762 1195 100 Plus
3R 32079331 3R 9335699..9335839 160..300 705 100 Plus
3R 32079331 3R 9335496..9335635 22..161 700 100 Plus
3R 32079331 3R 9335900..9336029 301..430 650 100 Plus
3R 32079331 3R 9336157..9336253 430..526 485 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:51:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9077610..9078091 763..1244 2410 100 Plus
3R 31820162 3R 9077312..9077550 524..762 1195 100 Plus
3R 31820162 3R 9076530..9076670 160..300 705 100 Plus
3R 31820162 3R 9076327..9076466 22..161 700 100 Plus
3R 31820162 3R 9076731..9076860 301..430 650 100 Plus
3R 31820162 3R 9076988..9077084 430..526 485 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:49:48 has no hits.

LD42595.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:50:42 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5160995..5161016 1..22 100 -> Plus
chr3R 5161261..5161399 23..161 100 -> Plus
chr3R 5161465..5161603 162..300 100 -> Plus
chr3R 5161664..5161793 301..430 100 -> Plus
chr3R 5161922..5162016 431..525 100 -> Plus
chr3R 5162247..5162483 526..762 100 -> Plus
chr3R 5162543..5163020 763..1240 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:25:09 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
CG8121-RB 1..777 88..864 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:16:15 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
CG8121-RB 1..777 88..864 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:13:11 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
CG8121-RA 1..777 88..864 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:47:41 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
CG8121-RB 1..777 88..864 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:10:41 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
CG8121-RA 1..777 88..864 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:10:23 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
CG8121-RA 57..1296 1..1240 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:16:15 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
CG8121-RA 57..1296 1..1240 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:13:11 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
CG8121-RA 62..1301 1..1240 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:47:41 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
CG8121-RA 57..1296 1..1240 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:10:41 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
CG8121-RA 62..1301 1..1240 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:50:42 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9336158..9336252 431..525 100 -> Plus
3R 9335231..9335252 1..22 100 -> Plus
3R 9335497..9335635 23..161 100 -> Plus
3R 9335701..9335839 162..300 100 -> Plus
3R 9335900..9336029 301..430 100 -> Plus
3R 9336483..9336719 526..762 100 -> Plus
3R 9336779..9337256 763..1240 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:50:42 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9336158..9336252 431..525 100 -> Plus
3R 9335231..9335252 1..22 100 -> Plus
3R 9335497..9335635 23..161 100 -> Plus
3R 9335701..9335839 162..300 100 -> Plus
3R 9335900..9336029 301..430 100 -> Plus
3R 9336483..9336719 526..762 100 -> Plus
3R 9336779..9337256 763..1240 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:50:42 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9336158..9336252 431..525 100 -> Plus
3R 9335231..9335252 1..22 100 -> Plus
3R 9335497..9335635 23..161 100 -> Plus
3R 9335701..9335839 162..300 100 -> Plus
3R 9335900..9336029 301..430 100 -> Plus
3R 9336483..9336719 526..762 100 -> Plus
3R 9336779..9337256 763..1240 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:13:11 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5160953..5160974 1..22 100 -> Plus
arm_3R 5161219..5161357 23..161 100 -> Plus
arm_3R 5161423..5161561 162..300 100 -> Plus
arm_3R 5161622..5161751 301..430 100 -> Plus
arm_3R 5161880..5161974 431..525 100 -> Plus
arm_3R 5162205..5162441 526..762 100 -> Plus
arm_3R 5162501..5162978 763..1240 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:25:42 Download gff for LD42595.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9076062..9076083 1..22 100 -> Plus
3R 9076328..9076466 23..161 100 -> Plus
3R 9076532..9076670 162..300 100 -> Plus
3R 9076731..9076860 301..430 100 -> Plus
3R 9076989..9077083 431..525 100 -> Plus
3R 9077314..9077550 526..762 100 -> Plus
3R 9077610..9078087 763..1240 100   Plus

LD42595.hyp Sequence

Translation from 87 to 863

> LD42595.hyp
MMNYGRKTPSTYRSNPSVYSHATGRSSTNLHSKMSRSTRSVRIPWYQRPL
LKNNQYIDIQKGAMLVGLFAIFLSLFTIATSIFDIYCYAMAAPGSTHYGY
YIISYEFVYVGNKHVRNMLIVFALFSLIMALINFVTSVLLCVALRKEYER
KVMPWLWSFAIFTVWRALALIFFAIVNDLYFAYNVIMVLLWTIFCVLSIY
GWAVVYSLFLELVDLTKLEDLAHLRMGTMASLHASTANSLAGSRPTTPHS
TVSTMPVG*

LD42595.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG8121-PB 258 CG8121-PB 1..258 1..258 1338 100 Plus
CG8121-PC 258 CG8121-PC 1..258 1..258 1338 100 Plus
CG8121-PA 258 CG8121-PA 1..258 1..258 1338 100 Plus

LD42595.pep Sequence

Translation from 87 to 863

> LD42595.pep
MMNYGRKTPSTYRSNPSVYSHATGRSSTNLHSKMSRSTRSVRIPWYQRPL
LKNNQYIDIQKGAMLVGLFAIFLSLFTIATSIFDIYCYAMAAPGSTHYGY
YIISYEFVYVGNKHVRNMLIVFALFSLIMALINFVTSVLLCVALRKEYER
KVMPWLWSFAIFTVWRALALIFFAIVNDLYFAYNVIMVLLWTIFCVLSIY
GWAVVYSLFLELVDLTKLEDLAHLRMGTMASLHASTANSLAGSRPTTPHS
TVSTMPVG*

LD42595.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17205-PA 257 GF17205-PA 1..257 2..258 1334 96.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16299-PA 258 GG16299-PA 1..258 1..258 1355 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22361-PA 257 GH22361-PA 1..257 2..258 1329 96.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
pasi2-PB 258 CG8121-PB 1..258 1..258 1338 100 Plus
pasi2-PC 258 CG8121-PC 1..258 1..258 1338 100 Plus
pasi2-PA 258 CG8121-PA 1..258 1..258 1338 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24001-PA 257 GI24001-PA 1..257 2..258 1332 95.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13813-PA 217 GL13813-PA 1..200 2..201 1018 95 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20837-PA 257 GA20837-PA 1..257 2..258 1338 96.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23795-PA 258 GM23795-PA 1..258 1..258 1361 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18605-PA 258 GD18605-PA 1..258 1..258 1360 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23633-PA 257 GJ23633-PA 1..257 2..258 1324 95.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11366-PA 257 GK11366-PA 1..257 2..258 1322 96.1 Plus
Dwil\GK15295-PA 227 GK15295-PA 166..227 197..258 283 91.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25941-PA 258 GE25941-PA 1..258 1..258 1351 98.8 Plus