Clone LD43384 Report

Search the DGRC for LD43384

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:433
Well:84
Vector:pOT2
Associated Gene/Transcripthalo-RB
Protein status:LD43384.pep: gold
Sequenced Size:602

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
halo 2011-03-17 Manual selection by Sue Celniker

Clone Sequence Records

LD43384.complete Sequence

602 bp assembled on 2011-04-26

GenBank Submission: BT126354.1

> LD43384.complete
ATCTCTGCGCAGCACTCATATTCCCAGTAAATCAGTTGGCATATATTCGA
TAATGGCCGAGCTACTTTTTCCACAACTGGAGCGTCCTTTGCCCTCGCTG
CCATCGCTGCACTACACCCTGTTTGCCTACAGGGAGGAGTTGCGACGCCG
CGATGCCCCGTTCATGAAGATGTCCACCATCAAGCTGCATCTCACGGACA
ACCTCATCCTGCAGACGATCAAGAACATCCGGCAGTATGACACCATCGAG
ATTATGAATCTCAACCAGGAGATAAACTTCAAGCGGCGGCTGACCAAACA
AATGAGGAAGGTGCGCAAACTGGAGAAGCTCGGCTTGCACATCGATCCCC
GGAAACTCAACGAGGACGGCAAATGGCACTGAAGTCCGATTAAATGGAAC
TCCAGAATCTAATCGCCCATCTAAACGCTATCGTATTCATATACACACCC
CCCCAACTATACTTACATACTCTGAGCATGTGAAATTAGATCGTAAGCAA
TGTCTCCTCAAGTTTCTAAAACTCCATAAGCCATACTAACCATACTAAGT
CTATCTGAAATAAAAACAAAAATTAAAAATTAAAAAAAAAAAAAAAAAAA
AA

LD43384.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1517422..1518002 581..1 2890 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1517532..1518113 582..1 2910 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1517532..1518113 582..1 2910 100 Minus
Blast to na_te.dros performed 2019-03-15 10:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 3872..3966 294..390 128 61.9 Plus

LD43384.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:35:53 Download gff for LD43384.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1517446..1518002 1..557 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-27 15:22:50 Download gff for LD43384.complete
Subject Subject Range Query Range Percent Splice Strand
halo-RA 72..453 1..382 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:20:40 Download gff for LD43384.complete
Subject Subject Range Query Range Percent Splice Strand
halo-RB 1..330 53..382 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:07:18 Download gff for LD43384.complete
Subject Subject Range Query Range Percent Splice Strand
halo-RB 1..330 53..382 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-27 15:22:50 Download gff for LD43384.complete
Subject Subject Range Query Range Percent Splice Strand
halo-RB 33..589 1..557 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:20:40 Download gff for LD43384.complete
Subject Subject Range Query Range Percent Splice Strand
halo-RB 36..592 1..557 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:07:18 Download gff for LD43384.complete
Subject Subject Range Query Range Percent Splice Strand
halo-RB 36..592 1..557 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:53 Download gff for LD43384.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1517557..1518113 1..557 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:53 Download gff for LD43384.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1517557..1518113 1..557 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:53 Download gff for LD43384.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1517557..1518113 1..557 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:20:40 Download gff for LD43384.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1517557..1518113 1..557 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:59:53 Download gff for LD43384.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1517557..1518113 1..557 100   Minus

LD43384.hyp Sequence

Translation from 0 to 381

> LD43384.hyp
SLRSTHIPSKSVGIYSIMAELLFPQLERPLPSLPSLHYTLFAYREELRRR
DAPFMKMSTIKLHLTDNLILQTIKNIRQYDTIEIMNLNQEINFKRRLTKQ
MRKVRKLEKLGLHIDPRKLNEDGKWH*

LD43384.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
halo-PB 109 CG7428-PB 1..109 18..126 565 100 Plus
CG13711-PA 127 CG13711-PA 37..115 34..112 165 32.9 Plus
CG13713-PA 99 CG13713-PA 9..81 34..106 143 37 Plus
CG13716-PA 117 CG13716-PA 24..94 31..101 135 40.8 Plus

LD43384.pep Sequence

Translation from 1 to 381

> LD43384.pep
SLRSTHIPSKSVGIYSIMAELLFPQLERPLPSLPSLHYTLFAYREELRRR
DAPFMKMSTIKLHLTDNLILQTIKNIRQYDTIEIMNLNQEINFKRRLTKQ
MRKVRKLEKLGLHIDPRKLNEDGKWH*

LD43384.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14039-PA 112 GF14039-PA 1..103 18..120 503 95.1 Plus
Dana\GF25089-PA 124 GF25089-PA 34..112 34..112 141 31.6 Plus
Dana\GF25088-PA 102 GF25088-PA 9..84 34..109 135 38.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24588-PA 109 GG24588-PA 1..109 18..126 561 99.1 Plus
Dere\GG15245-PA 126 GG15245-PA 36..114 34..112 142 30.4 Plus
Dere\GG14170-PA 120 GG14170-PA 23..97 26..101 136 42.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10326-PA 108 GH10326-PA 1..104 18..121 457 86.5 Plus
Dgri\GH15695-PA 111 GH15695-PA 21..99 34..112 150 35.4 Plus
Dgri\GH15694-PA 88 GH15694-PA 9..85 34..110 140 40.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
halo-PB 109 CG7428-PB 1..109 18..126 565 100 Plus
CG13711-PA 127 CG13711-PA 37..115 34..112 165 32.9 Plus
CG13713-PA 99 CG13713-PA 9..81 34..106 143 37 Plus
CG13716-PA 117 CG13716-PA 24..94 31..101 135 40.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17083-PA 108 GI17083-PA 1..108 18..126 457 84.4 Plus
Dmoj\GI12748-PA 116 GI12748-PA 23..104 31..112 155 35.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14763-PA 109 GL14763-PA 1..109 18..126 523 91.7 Plus
Dper\GL17913-PA 103 GL17913-PA 9..84 34..109 130 36.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20343-PA 109 GA20343-PA 1..109 18..126 523 91.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16605-PA 109 GM16605-PA 1..109 18..126 564 99.1 Plus
Dsec\GM14678-PA 126 GM14678-PA 36..114 34..112 150 32.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22905-PA 109 GD22905-PA 1..109 18..126 564 99.1 Plus
Dsim\GD13861-PA 146 GD13861-PA 36..114 34..112 149 32.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10727-PA 108 GJ10727-PA 1..107 18..125 467 86.1 Plus
Dvir\GJ15515-PA 90 GJ15515-PA 9..84 34..109 148 40.8 Plus
Dvir\GJ15516-PA 115 GJ15516-PA 25..103 34..112 142 34.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14944-PA 113 GK14944-PA 1..108 18..126 513 93.6 Plus
Dwil\GK16598-PA 121 GK16598-PA 30..109 33..112 151 35 Plus
Dwil\GK16597-PA 97 GK16597-PA 10..85 34..109 131 36.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15555-PA 109 GE15555-PA 1..109 18..126 550 96.3 Plus
Dyak\GE21467-PA 120 GE21467-PA 21..108 24..112 157 32.6 Plus