Clone LD43683 Report

Search the DGRC for LD43683

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:436
Well:83
Vector:pOT2
Associated Gene/Transcriptobst-A-RA
Protein status:LD43683.pep: gold
Preliminary Size:1364
Sequenced Size:1215

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17052 2001-01-01 Release 2 assignment
CG17052 2002-07-13 Blastp of sequenced clone
CG17052 2003-01-01 Sim4 clustering to Release 3
obst-A 2008-04-29 Release 5.5 accounting
obst-A 2008-08-15 Release 5.9 accounting
obst-A 2008-12-18 5.12 accounting

Clone Sequence Records

LD43683.complete Sequence

1215 bp (1215 high quality bases) assembled on 2002-07-13

GenBank Submission: BT001512

> LD43683.complete
CTTGAGTCGCGATTAGTTGCTCAAGTATCCAGTTGCCAGGATCGTTGCTC
TGCTTTTTTTTTTCTCAGACCCCGAGTCCAAAATGAAGTTATTTTTATGT
GCCATTGCTGTGACCCTGTGTGTGGCGACAACCGTGTCCGCCGCCAACTT
CGAGTGCCCGAAGCCCAATGGCCAGTTCGCCGATGAGGTGCAGTGCGACA
AGTTCTACGTCTGCGACGACGGAGTGGCCAAGGCGAAGCTCTGTCCCGAT
GGCCTGGTCTTCGATCCACTCAACCGCAAGTTCAACAAGTGCGACCAGCC
CTTCAATGTGGACTGCGAGGACCGCACTGAGCTCCAGGAGCCGAAGTCCA
GCAAGTACTGCCCGCGCAAGAACGGCTTCTTCGCGCATCCCGATCCCGCC
GTGTGCAACATCTTCTACAACTGCATCGAAGGCGACGCCCTGGAGACCAA
GTGCACCGTCGGCCTCCACTTCGACGAGTACTCGGGCACCTGCGTGTGGC
CGGATACCGCTAAGCGCGAGGGCTGCAATCCGGAGCAGAGAACCTCCGAG
ACCGGCTTCGTGTGCCCCAAGGATCAGCCAAAGACCGACGATCGCGGCCA
GGTGGTGACCCACCCCAAGTATCCGCATCCCACCGACTGCCAGAAGTTCT
ACGTGTGCCTGAACGGCGAGGATCCCAGGGATCTGGGCTGCCAGCTGGGC
GAGGTCTACAACGATGCCACCGAGATGTGCGATGCTCCCGAGAATGTGCC
CGGCTGCGAGGACTGGTACAAGGATGTGGACGACAAGAAGGACTAAGCCA
CTTCCGGTCGCTTCTACTTCTCCTCATCACATCCACACTCACAACTCATG
CACATGCACACGCACACACAAGCACACTGAAAGAAATTATCAATCAAATC
AAATCGAAACAATTCGAAACAAATCAACACACAGATTCGCGTCTTAGTCA
CTTAAATTTAGTAGTTCTAGCCCATTTCCTATAGAGCGTATGTGTAGCAG
TTAAACTTCAATACTCTGACCTATCTATTTCTTAACTATCTTTCTCTATA
TCTGACTACTTCTAACTACTTTTCTAACTACCCAAATCTCCATTTCTGTG
CCCAACCAAACGCTGCCAAATTGTTGTGTATATATTTCCCGCTTTCAGAC
TTTCGCCTTATTATTATACAAAAAGAATAAACTGAATTTTTTATAAAAAA
AAAAAAAAAAAAAAA

LD43683.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
obst-A-RA 1949 obst-A-RA 82..1277 1..1197 5945 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20107470..20108124 540..1194 3260 99.8 Plus
chrX 22417052 chrX 20107196..20107400 336..540 1025 100 Plus
chrX 22417052 chrX 20106647..20106850 132..335 1020 100 Plus
chrX 22417052 chrX 20105482..20105611 1..131 605 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:39:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20241885..20242542 540..1197 3290 100 Plus
X 23542271 X 20241611..20241815 336..540 1025 100 Plus
X 23542271 X 20241062..20241265 132..335 1020 100 Plus
X 23542271 X 20239897..20240026 1..131 605 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:16:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20227024..20227681 540..1197 3290 100 Plus
X 23527363 X 20226750..20226954 336..540 1025 100 Plus
X 23527363 X 20226201..20226404 132..335 1020 100 Plus
X 23527363 X 20225036..20225165 1..131 615 99.2 Plus
Blast to na_te.dros performed 2019-03-16 20:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 3901..3940 922..883 110 75 Minus

LD43683.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:05:59 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20105482..20105611 1..131 99 -> Plus
chrX 20106647..20106850 132..335 100 -> Plus
chrX 20107196..20107399 336..539 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:26:23 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
obst-A-RA 1..714 83..796 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:17:11 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
obst-A-RA 1..714 83..796 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:39:32 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
obst-A-RA 1..714 83..796 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:08:22 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
obst-A-RA 1..714 83..796 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:52:42 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
obst-A-RA 1..714 83..796 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:41:26 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
obst-A-RA 38..1230 1..1194 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:17:11 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
obst-A-RA 38..1230 1..1194 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:39:32 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
obst-A-RA 43..1235 1..1194 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:08:22 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
obst-A-RA 38..1230 1..1194 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:52:42 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
obst-A-RA 43..1235 1..1194 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:59 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
X 20239897..20240026 1..131 99 -> Plus
X 20241062..20241265 132..335 100 -> Plus
X 20241611..20241814 336..539 100 -> Plus
X 20241885..20242539 540..1194 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:59 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
X 20239897..20240026 1..131 99 -> Plus
X 20241062..20241265 132..335 100 -> Plus
X 20241611..20241814 336..539 100 -> Plus
X 20241885..20242539 540..1194 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:59 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
X 20239897..20240026 1..131 99 -> Plus
X 20241062..20241265 132..335 100 -> Plus
X 20241611..20241814 336..539 100 -> Plus
X 20241885..20242539 540..1194 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:39:32 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20112685..20112888 336..539 100 -> Plus
arm_X 20110971..20111100 1..131 99 -> Plus
arm_X 20112136..20112339 132..335 100 -> Plus
arm_X 20112959..20113613 540..1194 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:40:19 Download gff for LD43683.complete
Subject Subject Range Query Range Percent Splice Strand
X 20227024..20227678 540..1194 100   Plus
X 20225036..20225165 1..131 99 -> Plus
X 20226201..20226404 132..335 100 -> Plus
X 20226750..20226953 336..539 100 -> Plus

LD43683.hyp Sequence

Translation from 0 to 795

> LD43683.hyp
LESRLVAQVSSCQDRCSAFFFSDPESKMKLFLCAIAVTLCVATTVSAANF
ECPKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQP
FNVDCEDRTELQEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETK
CTVGLHFDEYSGTCVWPDTAKREGCNPEQRTSETGFVCPKDQPKTDDRGQ
VVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCDAPENVP
GCEDWYKDVDDKKD*

LD43683.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
obst-A-PB 237 CG17052-PB 1..237 28..264 1356 100 Plus
obst-A-PA 237 CG17052-PA 1..237 28..264 1356 100 Plus
obst-B-PA 337 CG4778-PA 85..284 51..258 548 46.6 Plus
Gasp-PB 235 CG10287-PB 1..228 28..262 432 37.4 Plus
Gasp-PA 258 CG10287-PA 1..228 28..262 429 37 Plus

LD43683.pep Sequence

Translation from 82 to 795

> LD43683.pep
MKLFLCAIAVTLCVATTVSAANFECPKPNGQFADEVQCDKFYVCDDGVAK
AKLCPDGLVFDPLNRKFNKCDQPFNVDCEDRTELQEPKSSKYCPRKNGFF
AHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAKREGCNP
EQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNGEDPRD
LGCQLGEVYNDATEMCDAPENVPGCEDWYKDVDDKKD*

LD43683.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20239-PA 239 GF20239-PA 1..239 1..237 1194 96.2 Plus
Dana\GF15739-PA 322 GF15739-PA 75..274 24..231 495 46.6 Plus
Dana\GF18629-PA 257 GF18629-PA 1..229 1..236 390 36.9 Plus
Dana\GF14304-PA 237 GF14304-PA 13..219 24..231 333 37.6 Plus
Dana\GF14303-PA 242 GF14303-PA 3..227 2..231 276 29.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19275-PA 237 GG19275-PA 1..237 1..237 1244 99.6 Plus
Dere\GG10079-PA 333 GG10079-PA 85..284 24..231 498 46.6 Plus
Dere\GG10600-PA 258 GG10600-PA 1..229 1..236 392 36.9 Plus
Dere\GG24283-PA 250 GG24283-PA 6..236 8..236 332 35.4 Plus
Dere\GG19276-PA 230 GG19276-PA 1..223 1..224 248 28.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12617-PA 235 GH12617-PA 1..234 1..235 1089 86.8 Plus
Dgri\GH11070-PA 313 GH11070-PA 64..266 21..231 497 46.4 Plus
Dgri\GH14287-PA 255 GH14287-PA 1..229 1..236 383 36.5 Plus
Dgri\GH10690-PA 237 GH10690-PA 10..224 21..236 329 36.7 Plus
Dgri\GH10689-PA 249 GH10689-PA 6..222 8..227 271 30.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
obst-A-PB 237 CG17052-PB 1..237 1..237 1356 100 Plus
obst-A-PA 237 CG17052-PA 1..237 1..237 1356 100 Plus
obst-B-PA 337 CG4778-PA 85..284 24..231 548 46.6 Plus
Gasp-PB 235 CG10287-PB 1..228 1..235 432 37.4 Plus
Gasp-PA 258 CG10287-PA 1..228 1..235 429 37 Plus
obst-E-PB 249 CG11142-PB 6..225 8..225 384 38.1 Plus
obst-E-PA 242 CG11142-PA 6..221 8..225 317 32.3 Plus
Peritrophin-A-PB 230 CG17058-PB 6..230 5..230 269 29.3 Plus
Peritrophin-A-PA 230 CG17058-PA 6..230 5..230 269 29.3 Plus
Peritrophin-A-PC 157 CG17058-PC 6..154 5..151 192 30.9 Plus
Muc68D-PB 1514 CG6004-PB 1318..1486 28..196 182 32.4 Plus
CG43896-PB 1324 CG43896-PB 137..355 14..233 169 26.4 Plus
CG43896-PD 2113 CG43896-PD 137..355 14..233 169 26.4 Plus
CG43896-PC 2113 CG43896-PC 137..355 14..233 169 26.4 Plus
teq-PC 563 CG4821-PC 67..259 26..216 167 29.4 Plus
teq-PF 2379 CG4821-PF 67..259 26..216 167 29.4 Plus
teq-PG 2792 CG4821-PG 67..259 26..216 167 29.4 Plus
CG10725-PB 269 CG10725-PB 91..267 32..222 146 27.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11032-PA 247 GI11032-PA 1..237 1..237 1093 84.8 Plus
Dmoj\GI17587-PA 316 GI17587-PA 67..266 24..231 499 46.6 Plus
Dmoj\GI23181-PA 256 GI23181-PA 1..229 1..236 393 37.3 Plus
Dmoj\GI11221-PA 233 GI11221-PA 15..226 24..236 335 36.7 Plus
Dmoj\GI11215-PA 247 GI11215-PA 6..221 8..225 277 32.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13082-PA 238 GL13082-PA 1..238 1..237 1195 95.4 Plus
Dper\GL18956-PA 316 GL18956-PA 73..272 24..231 500 46.6 Plus
Dper\GL23484-PA 259 GL23484-PA 1..229 1..236 378 35.7 Plus
Dper\GL19117-PA 227 GL19117-PA 9..220 24..236 319 36.2 Plus
Dper\GL19116-PA 243 GL19116-PA 6..227 8..231 279 31.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14300-PA 238 GA14300-PA 1..238 1..237 1195 95.4 Plus
Dpse\GA18424-PA 316 GA18424-PA 73..272 24..231 500 46.6 Plus
Dpse\GA10221-PA 259 GA10221-PA 1..229 1..236 378 35.7 Plus
Dpse\GA25356-PA 228 GA25356-PA 10..221 24..236 319 36.2 Plus
Dpse\GA10790-PA 243 GA10790-PA 6..227 8..231 280 31.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23014-PA 226 GM23014-PA 1..226 1..237 1046 87.4 Plus
Dsec\GM17883-PA 334 GM17883-PA 85..284 24..231 498 46.6 Plus
Dsec\GM10569-PA 258 GM10569-PA 1..229 1..236 394 36.9 Plus
Dsec\GM17998-PA 242 GM17998-PA 6..227 8..231 279 31.4 Plus
Dsec\GM23015-PA 230 GM23015-PA 1..223 1..224 250 28.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17480-PA 429 GD17480-PA 167..332 16..181 873 97.6 Plus
Dsim\GD23651-PA 334 GD23651-PA 85..284 24..231 498 46.6 Plus
Dsim\GD19561-PA 258 GD19561-PA 3..229 2..236 389 36.2 Plus
Dsim\GD22632-PA 249 GD22632-PA 6..236 8..236 336 35.9 Plus
Dsim\GD17481-PA 230 GD17481-PA 11..223 8..224 247 29.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15813-PA 237 GJ15813-PA 1..237 1..237 1142 89.9 Plus
Dvir\GJ17929-PA 313 GJ17929-PA 67..266 24..231 506 46.6 Plus
Dvir\GJ14495-PA 256 GJ14495-PA 1..229 1..236 387 36.5 Plus
Dvir\GJ18329-PA 242 GJ18329-PA 13..229 19..236 327 36.3 Plus
Dvir\GJ18328-PA 247 GJ18328-PA 6..221 8..225 279 31.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25193-PA 233 GK25193-PA 1..230 1..231 1098 88.7 Plus
Dwil\GK12722-PA 309 GK12722-PA 63..262 24..231 493 45.7 Plus
Dwil\GK14210-PA 256 GK14210-PA 1..229 1..236 399 38.1 Plus
Dwil\GK15421-PA 234 GK15421-PA 7..216 21..231 336 38.4 Plus
Dwil\GK22307-PA 186 GK22307-PA 1..139 85..231 331 44.2 Plus
Dwil\GK22307-PA 186 GK22307-PA 5..126 21..139 144 36.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17864-PA 237 GE17864-PA 1..237 1..237 1249 100 Plus
Dyak\GE18893-PA 334 GE18893-PA 85..284 24..231 494 46.6 Plus
Dyak\GE24117-PA 258 GE24117-PA 1..229 1..236 387 36.5 Plus
Dyak\GE18979-PA 249 GE18979-PA 6..236 8..236 324 35 Plus
Dyak\GE17865-PA 230 GE17865-PA 1..223 1..224 247 28.8 Plus