Clone LD44234 Report

Search the DGRC for LD44234

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:442
Well:34
Vector:pOT2
Associated Gene/TranscriptProsbeta2-RA
Protein status:LD44234.pep: gold
Preliminary Size:3016
Sequenced Size:1038

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3329 2001-01-01 Release 2 assignment
CG3329 2001-07-04 Blastp of sequenced clone
CG3329 2003-01-01 Sim4 clustering to Release 3
Prosbeta2 2008-04-29 Release 5.5 accounting
Prosbeta2 2008-08-15 Release 5.9 accounting
Prosbeta2 2008-12-18 5.12 accounting

Clone Sequence Records

LD44234.complete Sequence

1038 bp (1038 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051976

> LD44234.complete
CCAGCTCTAGCAAGCATTTAACAATTTTGTTTGTCATCGCGCTCGGCAGA
ATTAAAACCTTAGTTTTCCTTGCTAATATAGTTGAATTGAAGAATATATA
TAATGGATTTGGATAACGCACGCGATCTGCCCCGCGCTGGTTTCAATTTC
GACAACTGCAAGCGCAATGCAACTCTTTTGAATCGAGGCTTCAAGCCACC
GACCACCACCAAGACGGGAACCACAATCGTTGGCATCATCTACAAGGATG
GTGTTATTCTGGGCGCCGATACGCGAGCCACCGAGGGACCCATTGTCTCG
GACAAGAACTGCGCCAAGATCCATTACCTGGCCAAAAACATATACTGCTG
TGGAGCTGGAACCGCTGCGGACACTGAGATGACTACGGATCTCATCTCCT
CCCAGCTGGAGCTGCATCGCTTGCAGACAGATCGTGAGGTGCGCGTTGTG
GCCGCCAATACGATGTTGAAGCAGATGCTTTTCCGCTACCAGGGTCATAT
CAGTGCCGCTCTGGTGCTTGGTGGAGTGGATAAGACTGGACCCCACATCT
ATTCCATTCACCCACATGGAAGTTCGGATAAGCTGCCGTACGCCACCATG
GGATCGGGTTCCCTGGCCGCCATGACCGTTTTCGAAAGTCGCTGGAAACC
TGACTTGTCCGAAGAGGAGGGCAAGAAACTGGTGCGCGATGCCATCGCCT
CCGGAGTGTTTAACGATCTGGGTTCGGGATCCAACATCGATCTGTGTGTT
ATCCGCAAGGGCAGTGTTGAGTATCTGCGCAACTATGAGCTGGCTAACAA
GAAGGGCAAGCGCCAGTTGGACTACCGCTTCAAGACCGGAACCTCAACCG
TGCTGCACACCAACATTAAGGACCTACTCGTCACCGAACGCGTCCAGGCG
GTGCCCATGGAGATTTCTTAAAGCGATTCCCCTTTCTACCCTTTTCGTAC
ATTTATTATAATAAAGCTTCGGCAGGATCTATATGGAGTGGTTCAATAAA
GGAAGCCATGCTTCATCTTAAAAAAAAAAAAAAAAAAA

LD44234.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta2-RA 1061 Prosbeta2-RA 41..1061 1..1021 5105 100 Plus
Reck-RA 4255 Reck-RA 4174..4255 1021..940 410 100 Minus
Prosbeta2R1-RA 1165 Prosbeta2R1-RA 209..327 194..312 280 82.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14990717..14991391 345..1019 3360 99.9 Plus
chr3L 24539361 chr3L 14990271..14990451 164..344 905 100 Plus
chr3L 24539361 chr3L 14990038..14990201 1..164 820 100 Plus
chrX 22417052 chrX 5701620..5701722 210..312 275 84.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:39:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15000645..15001321 345..1021 3385 100 Plus
3L 28110227 3L 15000199..15000379 164..344 905 100 Plus
3L 28110227 3L 14999966..15000129 1..164 820 100 Plus
X 23542271 X 5809181..5809299 194..312 280 82.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14993745..14994421 345..1021 3385 100 Plus
3L 28103327 3L 14993299..14993479 164..344 905 100 Plus
3L 28103327 3L 14993066..14993229 1..164 820 100 Plus
X 23527363 X 5817279..5817397 194..312 280 82.3 Plus
Blast to na_te.dros performed on 2019-03-15 19:50:25 has no hits.

LD44234.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:51:05 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14990038..14990201 1..164 100 -> Plus
chr3L 14990272..14990451 165..344 100 -> Plus
chr3L 14990717..14991391 345..1019 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:27:15 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2-RA 1..819 103..921 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:59:13 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2-RA 1..819 103..921 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:02:42 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2-RA 1..819 103..921 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:42:29 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2-RA 1..819 103..921 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:09:00 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2-RA 1..819 103..921 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:14:13 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2-RA 11..1029 1..1019 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:59:13 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2-RA 31..1049 1..1019 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:02:42 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2-RA 16..1034 1..1019 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:42:30 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2-RA 11..1029 1..1019 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:09:00 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta2-RA 16..1034 1..1019 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:51:05 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14999966..15000129 1..164 100 -> Plus
3L 15000200..15000379 165..344 100 -> Plus
3L 15000645..15001319 345..1019 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:51:05 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14999966..15000129 1..164 100 -> Plus
3L 15000200..15000379 165..344 100 -> Plus
3L 15000645..15001319 345..1019 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:51:05 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14999966..15000129 1..164 100 -> Plus
3L 15000200..15000379 165..344 100 -> Plus
3L 15000645..15001319 345..1019 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:02:42 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14993066..14993229 1..164 100 -> Plus
arm_3L 14993300..14993479 165..344 100 -> Plus
arm_3L 14993745..14994419 345..1019 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:25:49 Download gff for LD44234.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14993745..14994419 345..1019 100   Plus
3L 14993066..14993229 1..164 100 -> Plus
3L 14993300..14993479 165..344 100 -> Plus

LD44234.pep Sequence

Translation from 102 to 920

> LD44234.pep
MDLDNARDLPRAGFNFDNCKRNATLLNRGFKPPTTTKTGTTIVGIIYKDG
VILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISS
QLELHRLQTDREVRVVAANTMLKQMLFRYQGHISAALVLGGVDKTGPHIY
SIHPHGSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIAS
GVFNDLGSGSNIDLCVIRKGSVEYLRNYELANKKGKRQLDYRFKTGTSTV
LHTNIKDLLVTERVQAVPMEIS*

LD44234.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23798-PA 272 GF23798-PA 1..272 1..272 1262 90.1 Plus
Dana\GF21212-PA 322 GF21212-PA 22..273 11..262 871 62.7 Plus
Dana\GF20928-PA 1093 GF20928-PA 23..264 13..253 498 41.6 Plus
Dana\GF19078-PA 569 GF19078-PA 15..201 38..223 283 33.7 Plus
Dana\GF13326-PA 229 GF13326-PA 10..200 34..223 250 28.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15711-PA 272 GG15711-PA 1..272 1..272 1410 96 Plus
Dere\GG18789-PA 307 GG18789-PA 20..277 11..267 869 63.2 Plus
Dere\GG11178-PA 322 GG11178-PA 22..270 12..259 529 42.5 Plus
Dere\GG22308-PA 224 GG22308-PA 10..217 34..253 262 27.6 Plus
Dere\GG20151-PA 282 GG20151-PA 73..254 39..219 242 33.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16666-PA 272 GH16666-PA 1..272 1..272 1192 84.6 Plus
Dgri\GH12772-PA 300 GH12772-PA 16..270 11..264 819 59.6 Plus
Dgri\GH17051-PA 299 GH17051-PA 4..211 15..224 366 38.7 Plus
Dgri\GH19825-PA 222 GH19825-PA 10..214 34..250 269 28.4 Plus
Dgri\GH20460-PA 280 GH20460-PA 73..244 39..209 231 33.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta2-PA 272 CG3329-PA 1..272 1..272 1407 100 Plus
Prosbeta2R1-PA 307 CG18341-PA 20..277 11..267 860 64.7 Plus
Prosbeta2R2-PA 322 CG12161-PA 22..279 12..268 533 43.7 Plus
Prosbeta1-PA 224 CG8392-PA 10..217 34..253 260 26.7 Plus
Prosbeta5-PA 282 CG12323-PA 73..254 39..219 237 33 Plus
Prosbeta5-PB 282 CG12323-PB 73..254 39..219 237 33 Plus
Prosbeta5R1-PA 315 CG9868-PA 71..247 39..214 195 31.8 Plus
Prosbeta5R2-PB 279 CG31742-PB 48..260 16..227 188 24.9 Plus
Prosbeta5R2-PA 279 CG31742-PA 48..260 16..227 188 24.9 Plus
Prosbeta4-PB 201 CG17331-PB 3..192 41..240 145 23.8 Plus
Prosbeta4-PA 201 CG17331-PA 3..192 41..240 145 23.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11352-PA 270 GI11352-PA 1..270 1..272 1290 88.2 Plus
Dmoj\GI15360-PA 313 GI15360-PA 16..270 11..264 838 62 Plus
Dmoj\GI12054-PA 322 GI12054-PA 16..222 13..218 461 42 Plus
Dmoj\GI20414-PA 222 GI20414-PA 10..215 34..240 252 27.4 Plus
Dmoj\GI18886-PA 279 GI18886-PA 73..247 39..212 230 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24711-PA 272 GL24711-PA 1..272 1..272 1221 86.4 Plus
Dper\GL15166-PA 327 GL15166-PA 11..281 2..268 903 63.5 Plus
Dper\GL21838-PA 312 GL21838-PA 22..228 13..218 457 44.4 Plus
Dper\GL22004-PA 298 GL22004-PA 17..255 14..251 439 42.3 Plus
Dper\GL10209-PA 225 GL10209-PA 10..223 34..251 269 29.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17382-PA 272 GA17382-PA 1..272 1..272 1219 86.4 Plus
Dpse\GA14896-PA 327 GA14896-PA 11..281 2..268 901 63.5 Plus
Dpse\GA26418-PA 312 GA26418-PA 22..228 13..218 457 44 Plus
Dpse\GA27343-PA 251 GA27343-PA 22..228 13..218 452 44.9 Plus
Dpse\GA21041-PA 225 GA21041-PA 10..223 34..259 269 28.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25498-PA 272 GM25498-PA 1..272 1..272 1441 98.9 Plus
Dsec\GM12440-PA 307 GM12440-PA 20..277 11..267 908 65.1 Plus
Dsec\GM10658-PA 322 GM10658-PA 22..258 12..236 526 44.7 Plus
Dsec\GM20098-PA 224 GM20098-PA 10..217 34..253 260 27.1 Plus
Dsec\GM21240-PA 282 GM21240-PA 73..254 39..219 243 33.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14518-PA 272 GD14518-PA 1..272 1..272 1444 99.3 Plus
Dsim\GD16756-PA 307 GD16756-PA 20..277 11..267 900 64.7 Plus
Dsim\GD19639-PA 322 GD19639-PA 22..270 12..259 522 43 Plus
Dsim\GD10758-PA 282 GD10758-PA 73..254 39..219 243 33.5 Plus
Dsim\GD16019-PA 206 GD16019-PA 5..199 47..253 228 25.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11606-PA 270 GJ11606-PA 4..270 6..272 1207 87.6 Plus
Dvir\GJ16628-PA 304 GJ16628-PA 16..278 11..272 843 59.7 Plus
Dvir\GJ13326-PA 328 GJ13326-PA 15..222 12..218 492 45.2 Plus
Dvir\GJ20086-PA 222 GJ20086-PA 10..214 34..250 272 28.9 Plus
Dvir\GJ21921-PA 279 GJ21921-PA 53..244 15..209 234 32.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10550-PA 272 GK10550-PA 1..271 1..270 1288 87.1 Plus
Dwil\GK25153-PA 353 GK25153-PA 22..277 11..263 831 61.7 Plus
Dwil\GK18404-PA 359 GK18404-PA 22..241 12..230 500 42.7 Plus
Dwil\GK21488-PA 225 GK21488-PA 13..199 38..223 258 28.3 Plus
Dwil\GK15836-PA 283 GK15836-PA 73..247 39..212 222 31.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22042-PA 272 GE22042-PA 1..272 1..272 1343 96.7 Plus
Dyak\GE16434-PA 315 GE16434-PA 20..277 11..267 876 62.8 Plus
Dyak\GE25306-PA 324 GE25306-PA 22..279 12..268 538 40.9 Plus
Dyak\GE14105-PA 224 GE14105-PA 10..217 34..253 262 27.6 Plus
Dyak\Prosbeta5-PA 282 GE12841-PA 73..254 39..219 243 33.5 Plus

LD44234.hyp Sequence

Translation from 102 to 920

> LD44234.hyp
MDLDNARDLPRAGFNFDNCKRNATLLNRGFKPPTTTKTGTTIVGIIYKDG
VILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISS
QLELHRLQTDREVRVVAANTMLKQMLFRYQGHISAALVLGGVDKTGPHIY
SIHPHGSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIAS
GVFNDLGSGSNIDLCVIRKGSVEYLRNYELANKKGKRQLDYRFKTGTSTV
LHTNIKDLLVTERVQAVPMEIS*

LD44234.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta2-PA 272 CG3329-PA 1..272 1..272 1407 100 Plus
Prosbeta2R1-PA 307 CG18341-PA 20..277 11..267 860 64.7 Plus
Prosbeta2R2-PA 322 CG12161-PA 22..279 12..268 533 43.7 Plus
Prosbeta1-PA 224 CG8392-PA 10..217 34..253 260 26.7 Plus
Prosbeta5-PA 282 CG12323-PA 73..254 39..219 237 33 Plus