Clone LD44422 Report

Search the DGRC for LD44422

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:444
Well:22
Vector:pOT2
Associated Gene/TranscriptCG6674-RA
Protein status:LD44422.pep: gold
Preliminary Size:985
Sequenced Size:850

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6674 2001-01-01 Release 2 assignment
CG6674 2003-01-01 Sim4 clustering to Release 3
CG6674 2003-02-22 Blastp of sequenced clone
CG6674 2008-04-29 Release 5.5 accounting
CG6674 2008-08-15 Release 5.9 accounting
CG6674 2008-12-18 5.12 accounting

Clone Sequence Records

LD44422.complete Sequence

850 bp (850 high quality bases) assembled on 2003-02-22

GenBank Submission: BT004865

> LD44422.complete
CAAACACAACGCATTTAAGCAAATGCCATTTGTGCAGTTTAACTAAGTAA
AATGCAGGAATTTTCAGCCAAACGAGACGCTCTTTTCGCATGTCTCGACG
ATGCGAGCAAAGAGTTGCGGGGAACTGCCTTGGATCAGAGCAAGGCCAAG
GCGTTTTCCATCAATGCCCTCGATCGAGGAAACAAATCCGGAAACGAATC
CGGACAGGTGATGAACTACCGCCAGGGTCGCAGCATTGTTACTGGCCTCG
ATGCGGAGGATGGAAGACTGCGACGAATGCGCGGCAAGGAGAGCATTTTC
AAGAAGCCCGAACTCCCCATTGGACGCTGTTTGAAGCCAAGAAAAACGCC
AGATTACCAGGTAAACCCGCACAAATGGAAGAAGTACTCCCTGTCTGATG
TGGACATTTCCGAACAGAGCAACTCCGCCGCCGCCTTGTCCTTCCTGCGA
CAAATGGATGCACAGCGCGAGGCTGAGGGCGTCGATAACGAATCTCCACC
TACAGATGGCAAGATCGAGTTCAAGAGGACCAGCAAACTCAGCCGCAAGC
TCAAGAGCCTCAAACAGCAGGAGGTGGATGATGTGGAGCTGGATAAGCCG
CAGTTAAGAGGTTCCAAGCTGGTGATGCCTGAGTATGTAATTGGCCAAAA
GCCGCATAAGCCAAAGAAATGCAAAACCAAATCGGAACAGAGCCGTGCAG
CGGGAAAACTACAACTGTCCCACTTGGCGGAGGAGGATGAGCAGGATGAT
TAGGTTAAAATGTATGATCCTAAGATTATATTATATAATAATTAGTGTCC
CAATGAAATTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD44422.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG6674-RA 973 CG6674-RA 124..940 1..817 4070 99.8 Plus
CG6674.a 812 CG6674.a 415..812 415..812 1990 100 Plus
CG6674.a 812 CG6674.a 58..417 1..360 1800 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9962938..9963391 812..359 2225 99.3 Minus
chr3L 24539361 chr3L 9963449..9963810 362..1 1795 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:40:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9971146..9971604 817..359 2280 99.8 Minus
3L 28110227 3L 9971662..9972023 362..1 1810 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9964246..9964704 817..359 2280 99.7 Minus
3L 28103327 3L 9964762..9965123 362..1 1810 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:35:30 has no hits.

LD44422.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:36:34 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9962938..9963389 361..812 99 <- Minus
chr3L 9963451..9963810 1..360 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:27:32 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
CG6674-RA 1..702 52..753 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:48:49 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
CG6674-RA 1..702 52..753 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:07 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
CG6674-RA 1..702 52..753 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:40:15 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
CG6674-RA 1..702 52..753 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:36:56 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
CG6674-RA 1..702 52..753 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:01:20 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
CG6674-RA 28..839 1..812 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:48:49 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
CG6674-RA 28..839 1..812 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:07 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
CG6674-RA 32..843 1..812 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:40:15 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
CG6674-RA 28..839 1..812 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:36:56 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
CG6674-RA 32..843 1..812 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:36:34 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9971664..9972023 1..360 100   Minus
3L 9971151..9971602 361..812 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:36:34 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9971664..9972023 1..360 100   Minus
3L 9971151..9971602 361..812 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:36:34 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9971664..9972023 1..360 100   Minus
3L 9971151..9971602 361..812 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:07 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9964251..9964702 361..812 100 <- Minus
arm_3L 9964764..9965123 1..360 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:10:35 Download gff for LD44422.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9964251..9964702 361..812 100 <- Minus
3L 9964764..9965123 1..360 100   Minus

LD44422.hyp Sequence

Translation from 51 to 752

> LD44422.hyp
MQEFSAKRDALFACLDDASKELRGTALDQSKAKAFSINALDRGNKSGNES
GQVMNYRQGRSIVTGLDAEDGRLRRMRGKESIFKKPELPIGRCLKPRKTP
DYQVNPHKWKKYSLSDVDISEQSNSAAALSFLRQMDAQREAEGVDNESPP
TDGKIEFKRTSKLSRKLKSLKQQEVDDVELDKPQLRGSKLVMPEYVIGQK
PHKPKKCKTKSEQSRAAGKLQLSHLAEEDEQDD*

LD44422.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG6674-PA 233 CG6674-PA 1..233 1..233 1192 100 Plus
CG6674-PB 214 CG6674-PB 1..214 1..233 1058 91.8 Plus

LD44422.pep Sequence

Translation from 51 to 752

> LD44422.pep
MQEFSAKRDALFACLDDASKELRGTALDQSKAKAFSINALDRGNKSGNES
GQVMNYRQGRSIVTGLDAEDGRLRRMRGKESIFKKPELPIGRCLKPRKTP
DYQVNPHKWKKYSLSDVDISEQSNSAAALSFLRQMDAQREAEGVDNESPP
TDGKIEFKRTSKLSRKLKSLKQQEVDDVELDKPQLRGSKLVMPEYVIGQK
PHKPKKCKTKSEQSRAAGKLQLSHLAEEDEQDD*

LD44422.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23850-PA 237 GF23850-PA 1..237 1..233 960 78.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13991-PA 235 GG13991-PA 1..235 1..233 1135 93.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15406-PA 231 GH15406-PA 1..220 1..225 744 66.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG6674-PA 233 CG6674-PA 1..233 1..233 1192 100 Plus
CG6674-PB 214 CG6674-PB 1..214 1..233 1058 91.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13011-PA 237 GI13011-PA 1..236 1..233 866 73.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11850-PA 243 GL11850-PA 1..229 1..228 851 72.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19770-PA 237 GA19770-PA 1..234 1..233 858 71.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24827-PA 233 GM24827-PA 1..233 1..233 1165 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12879-PA 198 GD12879-PA 1..196 1..196 987 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12103-PA 237 GJ12103-PA 1..237 1..233 870 71.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17414-PA 240 GK17414-PA 1..240 1..233 830 69.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20287-PA 235 GE20287-PA 1..235 1..233 1057 91.9 Plus