Clone LD44982 Report

Search the DGRC for LD44982

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:449
Well:82
Vector:pOT2
Associated Gene/TranscriptCG5190-RA
Protein status:LD44982.pep: gold
Preliminary Size:1562
Sequenced Size:1427

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5190 2001-01-01 Release 2 assignment
CG5190 2003-01-01 Sim4 clustering to Release 3
CG5190 2003-05-21 Blastp of sequenced clone
CG5190 2008-04-29 Release 5.5 accounting
CG5190 2008-08-15 Release 5.9 accounting
CG5190 2008-12-18 5.12 accounting

Clone Sequence Records

LD44982.complete Sequence

1427 bp (1427 high quality bases) assembled on 2003-05-21

GenBank Submission: AY119619

> LD44982.complete
ATCTAGTTTTATAACATAGTTTACTGCCATTAAGGTATATTTTTAAAATG
CTGAAGCATTTTGCACGATGGCGTCTGGGCAGCCAGTTGCTAAAGGGATG
TGCCGCACCAGTGAGGCAAGCCTCCAAAACCTCCAGCGCAGAGAACCTGA
TAGCCGGCACAGAGGAACCCCAAAAAAAGTTCGTCAATCCGTTTTCCCAG
CCCGCTCCTGCGTTAAGTAATGATACGATATCAGAGAACAAGGAGGAACG
GGATAAGCGACTCAAGGTGCTGCAGCTGGAGGCGGACATTGCCCACCAGG
AGGGTCGGCGGGTGCCGTCACTGGAATTCTTTAAGGATCATCATTGGGAG
CACGTGCTGACGCTACCCACAAAATCAGCTAGGATCAAGTACTTTGGCTA
TCTCTGGCAAATCGAGATGAAGAAGGAGGCGGATCAACGCAAGAAGGCAG
AGCGAGCGAAGGAAGCCGAGCGGCGGGTTGCGGAGATGCGAAAGGAGCGC
GAGGAGAATACGCACATTATCTATGGCCTGGGACACACATCGTTGTTTCT
GCGTATCTATGATACCACTATTAATCACTGGCAGAACAACCGACTCACAC
GGGCCATGCAGTTTGCCCCCAAAATGGTTTTGGATTGCTCCTACGATGAG
CACATGAACAATCGGGAGGCTACCTATGCAGCAAAGCAATTGATGATGTG
CTTTGCGGAGAACCGGATGAATGATGAGCCCTTCGATCTGCACTATTGCA
ACACCCAGATGGACAGCAGATGCATGCAGAGCCTCCAACGCTACATCCCC
ACCATGCACAATCCAGAGTTCCCGATAAATTTGCATAGCAAGTGCTTTAC
GGAACTCTTTCCCAAGCAGAACCTGGTCTACCTAACGCCCCACTGCCGGG
AGGATCTGGTCACTTACAACCCAGATGACATCTACATCGTGGGCGCCATG
GTAGACACTATGAACAACGAACCCCTTTCGCTGGCCAAAGCCAAACGATT
GGGCCTTCGGATGGCGAGACTGCCCCTGGATCGCTACCTACAGTGGGGTT
CCGGTTCGGGAAAGTCGCTAACTCTAAACCAGATGATCAACATTATGCTG
GACCTCAAGAAAACCGGCGACTGGGATACGGCCTTGAAGCATGTGCCCCG
TCGGAAGGTCGTGCAAAACGAATTCCAGCCGCGCAGGGAGAAAGATCATT
GGAGCACAGGCACGCGGGCCAGGAAGCTTAATATGCGAATCGATCATCTG
TTTGATTTTGACGAGAATCGCCGGCAGGCTACCTCCTATGCAACTCCGCA
GAATGTAAGGCAGCGACGGGAGGGCTTGGAGTTCCAACTGGACACTTGGG
CAACGGGGAAGCAAAAGAAAAAGCAGAGACAAAATTAAAGTTACTCGTTG
TATTCATTAAAAAAAAAAAAAAAAAAA

LD44982.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG5190-RA 1434 CG5190-RA 25..1434 1..1410 7050 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14338412..14339819 1..1408 6980 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:40:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18451329..18452738 1..1410 7050 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18452528..18453937 1..1410 7050 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:51:39 has no hits.

LD44982.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:52:41 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14338412..14339819 1..1408 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:28:14 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
CG5190-RA 1..1341 48..1388 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:35:35 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
CG5190-RA 1..1341 48..1388 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:02:57 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
CG5190-RA 1..1341 48..1388 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:11:28 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
CG5190-RA 1..1341 48..1388 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:09:26 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
CG5190-RA 1..1341 48..1388 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:38:32 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
CG5190-RA 25..1432 1..1408 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:35:35 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
CG5190-RA 62..1469 1..1408 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:02:57 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
CG5190-RA 46..1453 1..1408 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:11:28 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
CG5190-RA 25..1432 1..1408 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:09:26 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
CG5190-RA 46..1453 1..1408 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:52:41 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18451329..18452736 1..1408 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:52:41 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18451329..18452736 1..1408 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:52:41 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18451329..18452736 1..1408 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:02:57 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14338834..14340241 1..1408 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:47:53 Download gff for LD44982.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18452528..18453935 1..1408 100   Plus

LD44982.hyp Sequence

Translation from 47 to 1387

> LD44982.hyp
MLKHFARWRLGSQLLKGCAAPVRQASKTSSAENLIAGTEEPQKKFVNPFS
QPAPALSNDTISENKEERDKRLKVLQLEADIAHQEGRRVPSLEFFKDHHW
EHVLTLPTKSARIKYFGYLWQIEMKKEADQRKKAERAKEAERRVAEMRKE
REENTHIIYGLGHTSLFLRIYDTTINHWQNNRLTRAMQFAPKMVLDCSYD
EHMNNREATYAAKQLMMCFAENRMNDEPFDLHYCNTQMDSRCMQSLQRYI
PTMHNPEFPINLHSKCFTELFPKQNLVYLTPHCREDLVTYNPDDIYIVGA
MVDTMNNEPLSLAKAKRLGLRMARLPLDRYLQWGSGSGKSLTLNQMINIM
LDLKKTGDWDTALKHVPRRKVVQNEFQPRREKDHWSTGTRARKLNMRIDH
LFDFDENRRQATSYATPQNVRQRREGLEFQLDTWATGKQKKKQRQN*

LD44982.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG5190-PA 446 CG5190-PA 1..446 1..446 2379 100 Plus
CG14618-PA 319 CG14618-PA 43..285 127..384 174 22.3 Plus

LD44982.pep Sequence

Translation from 47 to 1387

> LD44982.pep
MLKHFARWRLGSQLLKGCAAPVRQASKTSSAENLIAGTEEPQKKFVNPFS
QPAPALSNDTISENKEERDKRLKVLQLEADIAHQEGRRVPSLEFFKDHHW
EHVLTLPTKSARIKYFGYLWQIEMKKEADQRKKAERAKEAERRVAEMRKE
REENTHIIYGLGHTSLFLRIYDTTINHWQNNRLTRAMQFAPKMVLDCSYD
EHMNNREATYAAKQLMMCFAENRMNDEPFDLHYCNTQMDSRCMQSLQRYI
PTMHNPEFPINLHSKCFTELFPKQNLVYLTPHCREDLVTYNPDDIYIVGA
MVDTMNNEPLSLAKAKRLGLRMARLPLDRYLQWGSGSGKSLTLNQMINIM
LDLKKTGDWDTALKHVPRRKVVQNEFQPRREKDHWSTGTRARKLNMRIDH
LFDFDENRRQATSYATPQNVRQRREGLEFQLDTWATGKQKKKQRQN*

LD44982.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11967-PA 447 GF11967-PA 1..447 1..446 1973 79.4 Plus
Dana\GF21002-PA 345 GF21002-PA 71..296 132..370 171 27.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:56:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21899-PA 446 GG21899-PA 1..446 1..446 2181 89.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:56:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19713-PA 453 GH19713-PA 1..448 1..440 1646 68.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
rswl-PA 446 CG5190-PA 1..446 1..446 2379 100 Plus
CG14618-PA 319 CG14618-PA 43..285 127..384 174 22.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20132-PA 452 GI20132-PA 1..451 1..444 1712 68.7 Plus
Dmoj\GI19729-PA 324 GI19729-PA 101..275 193..370 153 25.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17781-PA 447 GL17781-PA 1..445 1..443 1900 76.9 Plus
Dper\GL13297-PA 304 GL13297-PA 99..273 193..370 157 25.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18723-PA 447 GA18723-PA 1..445 1..443 1890 76.2 Plus
Dpse\GA13117-PA 304 GA13117-PA 99..273 193..370 162 26.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21890-PA 446 GM21890-PA 1..446 1..446 2315 94.8 Plus
Dsec\GM11730-PA 314 GM11730-PA 97..282 193..381 155 23.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11387-PA 446 GD11387-PA 1..446 1..446 2308 94.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19902-PA 450 GJ19902-PA 1..445 1..440 1721 70.5 Plus
Dvir\GJ14967-PA 306 GJ14967-PA 94..279 190..378 169 26.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23002-PA 442 GK23002-PA 1..442 1..446 1749 71.6 Plus
Dwil\GK16187-PA 330 GK16187-PA 104..279 192..370 165 26.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11974-PA 449 GE11974-PA 1..449 1..446 2215 89.5 Plus