Clone LD45302 Report

Search the DGRC for LD45302

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:453
Well:2
Vector:pOT2
Associated Gene/Transcriptsnf-RA
Protein status:LD45302.pep: gold
Preliminary Size:907
Sequenced Size:790

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4528 2001-01-01 Release 2 assignment
CG4528 2001-10-10 Blastp of sequenced clone
CG4528 2003-01-01 Sim4 clustering to Release 3
snf 2008-04-29 Release 5.5 accounting
snf 2008-08-15 Release 5.9 accounting
snf 2008-12-18 5.12 accounting

Clone Sequence Records

LD45302.complete Sequence

790 bp (790 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061491

> LD45302.complete
CAAATTGGTTGATTTTTGTCGAATTAAGTGAATAAAACGCACGACAGGAT
GGAGATGCTACCCAACCAAACGATTTACATCAACAATCTGAACGAGAAGA
TCAAGAAGGAGGAGCTAAAGAAGTCGCTCTATGCGATTTTCTCGCAATTC
GGCCAAATTCTGGACATTGTGGCCCTAAAAACGCTCAAAATGCGCGGCCA
GGCATTTGTGATCTTCAAGGAGATCGGCAGCGCTTCGAATGCCCTGCGCA
CCATGCAGGGCTTCCCGTTCTACGACAAGCCCATGCAGATCGCCTACTCC
AAATCCGATTCGGATATTGTGGCCAAGATAAAGGGTACCTTCAAGGAGCG
CCCCAAGAAGGTCAAGCCACCAAAACCAGCGCCGGGTACCGATGAGAAGA
AGGACAAGAAGAAGAAGCCGAGCAGCGCCGAGAACTCGAACCCGAACGCA
CAGACCGAGCAGCCGCCGAACCAGATCCTCTTCCTCACCAATCTGCCCGA
GGAGACCAACGAGATGATGCTGTCCATGCTGTTCAATCAGTTCCCCGGCT
TCAAGGAGGTGCGTCTTGTGCCGAATCGTCACGACATCGCCTTTGTGGAG
TTCACCACCGAGTTGCAGAGCAATGCCGCCAAGGAGGCGCTGCAGGGCTT
CAAGATTACGCCGACGCACGCCATGAAGATAACGTTCGCCAAGAAGTGAA
CGCAACTCCAGTCGCCGGGCGTTCCAGCAACTCCAATAATAATTTAAACT
ATAGAATAAATCGATATAAACAAAAAAAAAAAAAAAAAAA

LD45302.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
snf-RA 924 snf-RA 82..859 1..778 3875 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5201852..5202253 1..402 2010 100 Plus
chrX 22417052 chrX 5202678..5203047 402..771 1835 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:41:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5309306..5309707 1..402 2010 100 Plus
X 23542271 X 5310132..5310508 402..778 1870 99.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 5317404..5317805 1..402 2010 100 Plus
X 23527363 X 5318230..5318606 402..778 1870 99.7 Plus
Blast to na_te.dros performed on 2019-03-16 22:08:22 has no hits.

LD45302.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:09:03 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5201852..5202252 1..401 100 -> Plus
chrX 5202678..5203047 402..771 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:28:40 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
snf-RA 1..651 49..699 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:15 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
snf-RA 1..651 49..699 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:10:57 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
snf-RA 1..651 49..699 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:15 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
snf-RA 1..651 49..699 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:34:53 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
snf-RA 1..651 49..699 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:53 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
snf-RA 60..829 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:15 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
snf-RA 60..830 1..771 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:10:57 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
snf-RA 65..835 1..771 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:19:15 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
snf-RA 60..829 1..770 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:34:53 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
snf-RA 65..835 1..771 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:09:03 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
X 5310132..5310501 402..771 100   Plus
X 5309306..5309706 1..401 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:09:03 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
X 5310132..5310501 402..771 100   Plus
X 5309306..5309706 1..401 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:09:03 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
X 5310132..5310501 402..771 100   Plus
X 5309306..5309706 1..401 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:10:57 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5203339..5203739 1..401 100 -> Plus
arm_X 5204165..5204534 402..771 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:56:00 Download gff for LD45302.complete
Subject Subject Range Query Range Percent Splice Strand
X 5317404..5317804 1..401 100 -> Plus
X 5318230..5318599 402..771 100   Plus

LD45302.pep Sequence

Translation from 48 to 698

> LD45302.pep
MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRG
QAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKE
RPKKVKPPKPAPGTDEKKDKKKKPSSAENSNPNAQTEQPPNQILFLTNLP
EETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQG
FKITPTHAMKITFAKK*

LD45302.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21334-PA 216 GF21334-PA 1..216 1..216 914 95.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18748-PA 216 GG18748-PA 1..216 1..216 910 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24608-PA 216 GH24608-PA 1..216 1..216 901 94.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
snf-PA 216 CG4528-PA 1..216 1..216 1104 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\snf-PA 216 GI11070-PA 1..216 1..216 918 94.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14287-PA 216 GL14287-PA 1..216 1..216 883 93.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18235-PA 216 GA18235-PA 1..216 1..216 883 93.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12396-PA 216 GM12396-PA 1..216 1..216 1109 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24751-PA 169 GD24751-PA 1..169 48..216 877 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16850-PA 216 GJ16850-PA 1..216 1..216 897 94.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25839-PA 216 GK25839-PA 1..216 1..216 917 92.1 Plus
Dwil\GK22267-PA 69 GK22267-PA 1..48 69..116 193 85.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16390-PA 216 GE16390-PA 1..216 1..216 1088 96.3 Plus

LD45302.hyp Sequence

Translation from 48 to 698

> LD45302.hyp
MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRG
QAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKE
RPKKVKPPKPAPGTDEKKDKKKKPSSAENSNPNAQTEQPPNQILFLTNLP
EETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQG
FKITPTHAMKITFAKK*

LD45302.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
snf-PA 216 CG4528-PA 1..216 1..216 1104 100 Plus