BDGP Sequence Production Resources |
Search the DGRC for LD45302
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 453 |
Well: | 2 |
Vector: | pOT2 |
Associated Gene/Transcript | snf-RA |
Protein status: | LD45302.pep: gold |
Preliminary Size: | 907 |
Sequenced Size: | 790 |
Gene | Date | Evidence |
---|---|---|
CG4528 | 2001-01-01 | Release 2 assignment |
CG4528 | 2001-10-10 | Blastp of sequenced clone |
CG4528 | 2003-01-01 | Sim4 clustering to Release 3 |
snf | 2008-04-29 | Release 5.5 accounting |
snf | 2008-08-15 | Release 5.9 accounting |
snf | 2008-12-18 | 5.12 accounting |
790 bp (790 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061491
> LD45302.complete CAAATTGGTTGATTTTTGTCGAATTAAGTGAATAAAACGCACGACAGGAT GGAGATGCTACCCAACCAAACGATTTACATCAACAATCTGAACGAGAAGA TCAAGAAGGAGGAGCTAAAGAAGTCGCTCTATGCGATTTTCTCGCAATTC GGCCAAATTCTGGACATTGTGGCCCTAAAAACGCTCAAAATGCGCGGCCA GGCATTTGTGATCTTCAAGGAGATCGGCAGCGCTTCGAATGCCCTGCGCA CCATGCAGGGCTTCCCGTTCTACGACAAGCCCATGCAGATCGCCTACTCC AAATCCGATTCGGATATTGTGGCCAAGATAAAGGGTACCTTCAAGGAGCG CCCCAAGAAGGTCAAGCCACCAAAACCAGCGCCGGGTACCGATGAGAAGA AGGACAAGAAGAAGAAGCCGAGCAGCGCCGAGAACTCGAACCCGAACGCA CAGACCGAGCAGCCGCCGAACCAGATCCTCTTCCTCACCAATCTGCCCGA GGAGACCAACGAGATGATGCTGTCCATGCTGTTCAATCAGTTCCCCGGCT TCAAGGAGGTGCGTCTTGTGCCGAATCGTCACGACATCGCCTTTGTGGAG TTCACCACCGAGTTGCAGAGCAATGCCGCCAAGGAGGCGCTGCAGGGCTT CAAGATTACGCCGACGCACGCCATGAAGATAACGTTCGCCAAGAAGTGAA CGCAACTCCAGTCGCCGGGCGTTCCAGCAACTCCAATAATAATTTAAACT ATAGAATAAATCGATATAAACAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
snf-RA | 924 | snf-RA | 82..859 | 1..778 | 3875 | 99.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 5201852..5202252 | 1..401 | 100 | -> | Plus |
chrX | 5202678..5203047 | 402..771 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snf-RA | 1..651 | 49..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snf-RA | 1..651 | 49..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snf-RA | 1..651 | 49..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snf-RA | 1..651 | 49..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snf-RA | 1..651 | 49..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snf-RA | 60..829 | 1..770 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snf-RA | 60..830 | 1..771 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snf-RA | 65..835 | 1..771 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snf-RA | 60..829 | 1..770 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
snf-RA | 65..835 | 1..771 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 5310132..5310501 | 402..771 | 100 | Plus | |
X | 5309306..5309706 | 1..401 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 5310132..5310501 | 402..771 | 100 | Plus | |
X | 5309306..5309706 | 1..401 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 5310132..5310501 | 402..771 | 100 | Plus | |
X | 5309306..5309706 | 1..401 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 5203339..5203739 | 1..401 | 100 | -> | Plus |
arm_X | 5204165..5204534 | 402..771 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 5317404..5317804 | 1..401 | 100 | -> | Plus |
X | 5318230..5318599 | 402..771 | 100 | Plus |
Translation from 48 to 698
> LD45302.pep MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRG QAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKE RPKKVKPPKPAPGTDEKKDKKKKPSSAENSNPNAQTEQPPNQILFLTNLP EETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQG FKITPTHAMKITFAKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21334-PA | 216 | GF21334-PA | 1..216 | 1..216 | 914 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18748-PA | 216 | GG18748-PA | 1..216 | 1..216 | 910 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24608-PA | 216 | GH24608-PA | 1..216 | 1..216 | 901 | 94.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
snf-PA | 216 | CG4528-PA | 1..216 | 1..216 | 1104 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\snf-PA | 216 | GI11070-PA | 1..216 | 1..216 | 918 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14287-PA | 216 | GL14287-PA | 1..216 | 1..216 | 883 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18235-PA | 216 | GA18235-PA | 1..216 | 1..216 | 883 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12396-PA | 216 | GM12396-PA | 1..216 | 1..216 | 1109 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24751-PA | 169 | GD24751-PA | 1..169 | 48..216 | 877 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16850-PA | 216 | GJ16850-PA | 1..216 | 1..216 | 897 | 94.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25839-PA | 216 | GK25839-PA | 1..216 | 1..216 | 917 | 92.1 | Plus |
Dwil\GK22267-PA | 69 | GK22267-PA | 1..48 | 69..116 | 193 | 85.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16390-PA | 216 | GE16390-PA | 1..216 | 1..216 | 1088 | 96.3 | Plus |
Translation from 48 to 698
> LD45302.hyp MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRG QAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKE RPKKVKPPKPAPGTDEKKDKKKKPSSAENSNPNAQTEQPPNQILFLTNLP EETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQG FKITPTHAMKITFAKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
snf-PA | 216 | CG4528-PA | 1..216 | 1..216 | 1104 | 100 | Plus |