Clone LD45324 Report

Search the DGRC for LD45324

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:453
Well:24
Vector:pOT2
Associated Gene/TranscriptPrx5-RA
Protein status:LD45324.pep: gold
Preliminary Size:840
Sequenced Size:712

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7217 2001-01-01 Release 2 assignment
CG32920 2001-07-04 Blastp of sequenced clone
CG32920 2003-01-01 Sim4 clustering to Release 3
CG7217 2008-04-29 Release 5.5 accounting
CG7215 2008-08-15 Release 5.9 accounting
CG7217 2008-08-15 Release 5.9 accounting
CG7217 2008-12-18 5.12 accounting
CG7215 2008-12-18 5.12 accounting

Clone Sequence Records

LD45324.complete Sequence

712 bp (712 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051983

> LD45324.complete
AGAAATGCGTGTGCTGTCGTGCAAATTTCTTGGCCGAGTTGTTAACTCCG
CGCTGCCCCAACAAATCATTTCACTGCGATCCCTGTCCAAAACCAGTGCA
GCTATGGTGAAAGTAGGAGACTCCCTGCCATCGGTGGATCTGTTCGAGGA
CTCGCCAGCCAACAAAATCAACACCGGCGATCTCGTCAATGGCAAGAAGG
TGATCATCTTCGGCGTTCCCGGCGCCTTCACTCCAGGCTGCTCAAAGACC
CACTTGCCCGGCTATGTGAGCTCCGCCGATGAGCTGAAGTCCAAGCAGGG
CGTGGACGAGATTGTCTGCGTTTCGGTCAACGATCCCTTTGTGATGTCCG
CCTGGGGCAAGGAGCACGGAGCCGCGGGCAAGGTGCGCCTCCTAGCTGAT
CCCGCCGGCGGTTTCACCAAGGCCCTGGATGTGACCATCGATCTGCCACC
ACTTGGCGGCGTGCGCTCAAAGCGCTACTCGCTGGTGGTGGAGAACGGCA
AGGTGACCGAGCTGAATGTCGAGCCCGATGGCACCGGACTCAGCTGCTCG
CTGGCCAACAACATTGGCAAGAAGTAAATGGAATCCAGTCAGCCCGAAAA
CACTAGAAACTCATACATGCTAATGCTAGGCCGCAATGATATCAATTACG
TCTTCAAAAGAACTATGTAAAACGTACAATATATATGCGATTAGAAAAAA
AAAAAAAAAAAA

LD45324.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
Prx5-RB 756 Prx5-RB 56..750 1..695 3475 100 Plus
Prx5-RA 1421 Prx5-RA 721..1415 1..695 3475 100 Plus
CG7215-RA 1421 CG7215-RA 721..1415 1..695 3475 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13989815..13990263 694..246 2245 100 Minus
chr3R 27901430 chr3R 13990392..13990526 247..113 675 100 Minus
chr3R 27901430 chr3R 13990718..13990832 115..1 575 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:41:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18165448..18165897 695..246 2250 100 Minus
3R 32079331 3R 18166026..18166160 247..113 675 100 Minus
3R 32079331 3R 18166352..18166466 115..1 575 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17906279..17906728 695..246 2250 100 Minus
3R 31820162 3R 17906857..17906991 247..113 675 100 Minus
3R 31820162 3R 17907183..17907297 115..1 575 100 Minus
Blast to na_te.dros performed on 2019-03-15 13:52:56 has no hits.

LD45324.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:54:12 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13989815..13990261 248..694 100 <- Minus
chr3R 13990392..13990526 113..247 100 <- Minus
chr3R 13990721..13990832 1..112 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:28:43 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
CG7217-RB 1..573 5..577 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:15:41 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
Prx5-RB 1..573 5..577 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:15:08 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
Prx5-RA 1..573 5..577 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:47:05 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
CG7217-RB 1..573 5..577 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:43:11 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
Prx5-RA 1..573 5..577 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:09:33 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
CG7215-RA 721..1414 1..694 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:15:40 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
Prx5-RB 56..749 1..694 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:15:08 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
CG7215-RA 749..1442 1..694 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:47:05 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
CG7215-RA 721..1414 1..694 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:43:11 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
Prx5-RA 749..1442 1..694 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:54:12 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18165449..18165895 248..694 100 <- Minus
3R 18166026..18166160 113..247 100 <- Minus
3R 18166355..18166466 1..112 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:54:12 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18165449..18165895 248..694 100 <- Minus
3R 18166026..18166160 113..247 100 <- Minus
3R 18166355..18166466 1..112 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:54:12 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18165449..18165895 248..694 100 <- Minus
3R 18166026..18166160 113..247 100 <- Minus
3R 18166355..18166466 1..112 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:15:08 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13991171..13991617 248..694 100 <- Minus
arm_3R 13991748..13991882 113..247 100 <- Minus
arm_3R 13992077..13992188 1..112 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:25:02 Download gff for LD45324.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17906280..17906726 248..694 100 <- Minus
3R 17906857..17906991 113..247 100 <- Minus
3R 17907186..17907297 1..112 100   Minus

LD45324.hyp Sequence

Translation from 0 to 576

> LD45324.hyp
EMRVLSCKFLGRVVNSALPQQIISLRSLSKTSAAMVKVGDSLPSVDLFED
SPANKINTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADELKSKQG
VDEIVCVSVNDPFVMSAWGKEHGAAGKVRLLADPAGGFTKALDVTIDLPP
LGGVRSKRYSLVVENGKVTELNVEPDGTGLSCSLANNIGKK*

LD45324.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
Prx5-PB 190 CG7217-PB 1..190 2..191 969 100 Plus
Prx5-PA 190 CG7217-PA 1..190 2..191 969 100 Plus

LD45324.pep Sequence

Translation from 4 to 576

> LD45324.pep
MRVLSCKFLGRVVNSALPQQIISLRSLSKTSAAMVKVGDSLPSVDLFEDS
PANKINTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADELKSKQGV
DEIVCVSVNDPFVMSAWGKEHGAAGKVRLLADPAGGFTKALDVTIDLPPL
GGVRSKRYSLVVENGKVTELNVEPDGTGLSCSLANNIGKK*

LD45324.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18245-PA 157 GF18245-PA 1..157 34..190 807 98.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16729-PA 190 GG16729-PA 1..190 1..190 977 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17340-PA 157 GH17340-PA 1..157 34..190 734 87.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
Prx5-PB 190 CG7217-PB 1..190 1..190 969 100 Plus
Prx5-PA 190 CG7217-PA 1..190 1..190 969 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23880-PA 157 GI23880-PA 1..157 34..190 735 87.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12016-PA 189 GL12016-PA 1..189 1..190 882 90.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26161-PA 189 GA26161-PA 1..189 1..190 882 90.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15327-PA 190 GM15327-PA 1..190 1..190 974 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20203-PA 190 GD20203-PA 1..190 1..190 980 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23970-PA 184 GJ23970-PA 3..184 5..190 779 79.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11833-PA 185 GK11833-PA 1..185 4..190 821 85.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25237-PA 190 GE25237-PA 1..190 1..190 965 97.9 Plus