Clone LD45826 Report

Search the DGRC for LD45826

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:458
Well:26
Vector:pOT2
Associated Gene/TranscriptCG8067-RA
Protein status:LD45826.pep: gold
Preliminary Size:1304
Sequenced Size:1163

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8067 2001-01-01 Release 2 assignment
CG8067 2003-01-01 Sim4 clustering to Release 3
CG8067 2003-02-27 Blastp of sequenced clone
CG8067 2008-04-29 Release 5.5 accounting
CG8067 2008-08-15 Release 5.9 accounting
CG8067 2008-12-18 5.12 accounting

Clone Sequence Records

LD45826.complete Sequence

1163 bp (1163 high quality bases) assembled on 2003-02-27

GenBank Submission: AY061497

> LD45826.complete
CTTATTACAGCACTGCTCTGATCAAAAGTCGGAATATGTTAAGAAAATTA
ACAAAACTATCGACCTTAAAGGTCAAATGTGAACTCCGCGCCCTATCCTC
ACTCACCCAAACATCGCAACATATATTTGACCGCAATGCCAAGAGATTAC
AGAAGGAAAGGGCCGCACTCAGCGAAGACGTTGGACTATACGATTACTTG
AAGGAGGAGATCGGCTTCCGCCTGGCTGACAGAGTATTCGACATTAAGCG
GGAGTTCAAGGCGGCGGCGGATATCGGATGCAGTCGCGGCTATCTGTCCA
GACACATTCTGGCGGAGAGTGTGGAGCAGCTGACGCTCACGGACACCAGT
GCTACGATGCTGGAGCAGGCACAGGGCACTCCGGGTCTGAAAATGGTGAA
ACTAGTTAAGGACGAAGAGCAGCTGGATTTTGAGGACAATTCACTGGATC
TGGTCATCTCTAGCCTAAGTCTGCACTGGGTGAATGATCTGCCGGGCTGC
TTTGTCAGAATTAAGCAGAGTCTGAAACCGGATGGGGTCTTTATAGCCTC
CATGTTTGGTGGAGACACCCTCTACGAGCTGCGCTCCTCGCTCCAATTGG
CCGAGCTGGAGCGCAAAGGTGGCATATCTCCGCACATCTCGCCCTTCACT
CAGATTAGGGATATTGGTTCCCTGCTTAATCGCGCCGGCTTCACCATGCT
GACAATAGACACCGATGAACTGGTCATCGGCTATCCCAGCATGTTCGAAC
TGATGTGGGATCTCAAGGGTATGGCAGAGAACAATGCTGCATTCAATCGA
CCCGCTCATCTTAGTCGAGAAACGATGCTCGCGGCCAGTGCCATCTACCA
GGAGCTGTATGCAAAGCCCAACGAGAAGGGGATACCTGCAACCTTCCAAA
TCATCTACTTTGTGGGCTGGAAACCCGGTCCCAATCAGCCACAGCCTCTG
GAAAGAGGAACCGGTGAGGTGTCGCTCAAGGATCTAGGGTCGATTATCGA
AAAGGGCGGCAAGCTGGACACCAAAGCGGGAGATTAGCTTAGCTTCAGTT
GACAGTTTTATTTGGAGACGTTGTTGAACATAATTTAAATTAAAATATAC
ATAATTCCTTTTGCTGAGAAACTTAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAA

LD45826.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG8067-RA 1177 CG8067-RA 54..1177 1..1124 5620 100 Plus
CG8067.d 1200 CG8067.d 77..1200 1..1124 5620 100 Plus
CG8067.b 1200 CG8067.b 77..1200 1..1124 5620 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:55:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9871516..9872211 429..1124 3465 99.9 Plus
chr2R 21145070 chr2R 9871200..9871458 170..428 1295 100 Plus
chr2R 21145070 chr2R 9870970..9871141 1..172 845 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13984198..13984896 429..1127 3495 100 Plus
2R 25286936 2R 13983882..13984140 170..428 1295 100 Plus
2R 25286936 2R 13983652..13983823 1..172 860 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13985397..13986095 429..1127 3495 100 Plus
2R 25260384 2R 13985081..13985339 170..428 1295 100 Plus
2R 25260384 2R 13984851..13985022 1..172 860 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:55:27 has no hits.

LD45826.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:56:18 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9870970..9871141 1..172 99 -> Plus
chr2R 9871203..9871458 173..428 100 -> Plus
chr2R 9871516..9872211 429..1124 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:29:18 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
CG8067-RA 1..1002 36..1037 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:47:14 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
CG8067-RA 1..1002 36..1037 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:03:32 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
CG8067-RA 1..1002 36..1037 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:38:40 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
CG8067-RA 1..1002 36..1037 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:10:28 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
CG8067-RA 1..1002 36..1037 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:59:06 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
CG8067-RA 1..1124 1..1124 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:47:14 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
CG8067-RA 1..1124 1..1124 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:03:32 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
CG8067-RA 23..1146 1..1124 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:38:41 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
CG8067-RA 1..1124 1..1124 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:10:28 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
CG8067-RA 23..1146 1..1124 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:18 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13983885..13984140 173..428 100 -> Plus
2R 13983652..13983823 1..172 100 -> Plus
2R 13984198..13984893 429..1124 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:18 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13983885..13984140 173..428 100 -> Plus
2R 13983652..13983823 1..172 100 -> Plus
2R 13984198..13984893 429..1124 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:18 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13983885..13984140 173..428 100 -> Plus
2R 13983652..13983823 1..172 100 -> Plus
2R 13984198..13984893 429..1124 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:03:32 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9871157..9871328 1..172 100 -> Plus
arm_2R 9871390..9871645 173..428 100 -> Plus
arm_2R 9871703..9872398 429..1124 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:08:57 Download gff for LD45826.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13985084..13985339 173..428 100 -> Plus
2R 13985397..13986092 429..1124 100   Plus
2R 13984851..13985022 1..172 100 -> Plus

LD45826.hyp Sequence

Translation from 2 to 1036

> LD45826.hyp
YYSTALIKSRNMLRKLTKLSTLKVKCELRALSSLTQTSQHIFDRNAKRLQ
KERAALSEDVGLYDYLKEEIGFRLADRVFDIKREFKAAADIGCSRGYLSR
HILAESVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQLDFEDNSLDL
VISSLSLHWVNDLPGCFVRIKQSLKPDGVFIASMFGGDTLYELRSSLQLA
ELERKGGISPHISPFTQIRDIGSLLNRAGFTMLTIDTDELVIGYPSMFEL
MWDLKGMAENNAAFNRPAHLSRETMLAASAIYQELYAKPNEKGIPATFQI
IYFVGWKPGPNQPQPLERGTGEVSLKDLGSIIEKGGKLDTKAGD*

LD45826.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG8067-PB 333 CG8067-PB 1..333 12..344 1695 100 Plus
CG8067-PA 333 CG8067-PA 1..333 12..344 1695 100 Plus

LD45826.pep Sequence

Translation from 35 to 1036

> LD45826.pep
MLRKLTKLSTLKVKCELRALSSLTQTSQHIFDRNAKRLQKERAALSEDVG
LYDYLKEEIGFRLADRVFDIKREFKAAADIGCSRGYLSRHILAESVEQLT
LTDTSATMLEQAQGTPGLKMVKLVKDEEQLDFEDNSLDLVISSLSLHWVN
DLPGCFVRIKQSLKPDGVFIASMFGGDTLYELRSSLQLAELERKGGISPH
ISPFTQIRDIGSLLNRAGFTMLTIDTDELVIGYPSMFELMWDLKGMAENN
AAFNRPAHLSRETMLAASAIYQELYAKPNEKGIPATFQIIYFVGWKPGPN
QPQPLERGTGEVSLKDLGSIIEKGGKLDTKAGD*

LD45826.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13724-PA 333 GF13724-PA 1..333 1..333 1673 93.4 Plus
Dana\GF23120-PA 298 GF23120-PA 1..276 1..276 1362 93.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20416-PA 333 GG20416-PA 1..333 1..333 1731 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22834-PA 306 GH22834-PA 2..300 29..327 1466 89.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG8067-PB 333 CG8067-PB 1..333 1..333 1695 100 Plus
CG8067-PA 333 CG8067-PA 1..333 1..333 1695 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21212-PA 316 GI21212-PA 1..314 17..331 1461 84.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20032-PA 328 GL20032-PA 1..328 1..327 1622 93 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20800-PA 328 GA20800-PA 1..328 1..327 1622 93.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21502-PA 333 GM21502-PA 1..333 1..333 1749 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:55:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10997-PA 333 GD10997-PA 1..333 1..333 1753 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:55:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20813-PA 306 GJ20813-PA 2..300 29..327 1451 88.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23302-PA 331 GK23302-PA 18..330 17..330 1510 89.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12576-PA 333 GE12576-PA 1..333 1..333 1723 96.7 Plus