Clone LD45836 Report

Search the DGRC for LD45836

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:458
Well:36
Vector:pOT2
Associated Gene/TranscriptVps37B-RA
Protein status:LD45836.pep: gold
Preliminary Size:1066
Sequenced Size:949

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1115 2001-01-01 Release 2 assignment
CG1115 2003-01-01 Sim4 clustering to Release 3
CG1115 2003-02-27 Blastp of sequenced clone
CG1115 2008-04-29 Release 5.5 accounting
CG1115 2008-08-15 Release 5.9 accounting
CG1115 2008-12-18 5.12 accounting

Clone Sequence Records

LD45836.complete Sequence

949 bp (949 high quality bases) assembled on 2003-02-27

GenBank Submission: AY069687

> LD45836.complete
TTGCAGAGGGTCAGCGAAGATGTACCAGGAATACCTATACCAACTGCGGG
CCACCATCACCCCGATGTGCCACGAGGAGCTGAAGGAACTGCTGAACGAT
GACGACAAGCTGGACGAGAAGGTTGACGAAGTTCTCCAGGTGCTCCGAAC
ACAAAAGACCAGTGTTTTCGAGGACAACAGGAGTCGGGCGGAGCGCAATA
TCGAGCGGGAGCCGCAGATCATCGAGCTGCGGGGGCAGCTGGCAGAACTC
TCGGAGGATGGGCGCACCAGGTGCTCCTCTGTCCAGGAGAAACTCTCACA
GCTCAAGGAGAAGTCGGGCGGAGTGGGCCTTGAAACGGCGCTGGCCCTGC
TGCAGACAGCTGCCTCCGAGAGCGAGGAGCAGACCGAGGAGATGGTCAAG
AAGTTCAACGACAGCGATATCGGCGTGGAGGACTTTCTGGACGCGTTCCT
CCCTATCCGGAGGACCATGCACCTGCGTCGCCTCAAGGCCGAAAAAATGC
AGGAGCTGATGCGCAAACAGCGCCAGGGTCCGGGCCCAAATACTTCTCTG
CCAGCCTACGGAAACGTGCCCTCCAGCGGATTCTATCCCGCGTCTGGGGG
CTCCGCCCCTTACCCAATCATGGGTCCCCTGATGCCCATGCCACCGCCAT
CCAGACCGTACTGAGGTCTTGGTCCTTGGTCCTTGGTCCTCAGCGAATTA
ACTGCCATGGCGCATCAGTCTGCAGCAGAATCCTCTCTTTAAGTACATAT
TGCTTCAGTTTCATCTTCTGATTACAGTGGGTTAATTGCAAATCAGAGGG
AACTTTCTGGTACACACATCTCTGCCTGCACTAAACTATGATATATATGT
ATATGTGAAAGTATAAATTAAGCGAAAATTAACATTAATATTAGACAGTG
GACATTTCTTGTTAAAATAAAAACTTTCGATAAAAAAAAAAAAAAAAAA

LD45836.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:16:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG1115-RA 1083 CG1115-RA 153..1083 1..931 4655 100 Plus
katanin-60.c 2351 katanin-60.c 2107..2318 937..726 1060 100 Minus
katanin-60.b 2672 katanin-60.b 2428..2639 937..726 1060 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1051915..1052642 1..728 3640 100 Plus
chr3R 27901430 chr3R 1052985..1053190 726..931 1030 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5226251..5226978 1..728 3640 100 Plus
3R 32079331 3R 5227321..5227532 726..937 1060 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4967082..4967809 1..728 3640 100 Plus
3R 31820162 3R 4968152..4968363 726..937 1060 100 Plus
Blast to na_te.dros performed 2019-03-15 18:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
baggins 5453 baggins BAGGINS 5453bp 998..1050 257..309 111 74.5 Plus

LD45836.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:37:03 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1051915..1052642 1..728 100 -> Plus
chr3R 1052988..1053190 729..931 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:29:19 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
CG1115-RA 1..645 20..664 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:47:15 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
CG1115-RC 1..645 20..664 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:08:56 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
CG1115-RA 1..645 20..664 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:38:42 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
CG1115-RA 1..645 20..664 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:07:34 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
Vps37B-RA 1..645 20..664 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:59:08 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
CG1115-RA 92..1026 1..931 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:47:15 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
CG1115-RA 92..1022 1..931 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:08:56 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
CG1115-RA 94..1024 1..931 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:38:42 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
CG1115-RA 92..1026 1..931 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:07:34 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
Vps37B-RA 94..1024 1..931 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:37:03 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5226251..5226978 1..728 100 -> Plus
3R 5227324..5227526 729..931 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:37:03 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5226251..5226978 1..728 100 -> Plus
3R 5227324..5227526 729..931 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:37:03 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5226251..5226978 1..728 100 -> Plus
3R 5227324..5227526 729..931 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:08:56 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1053046..1053248 729..931 100   Plus
arm_3R 1051973..1052700 1..728 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:08:58 Download gff for LD45836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4967082..4967809 1..728 100 -> Plus
3R 4968155..4968357 729..931 100   Plus

LD45836.hyp Sequence

Translation from 0 to 663

> LD45836.hyp
CRGSAKMYQEYLYQLRATITPMCHEELKELLNDDDKLDEKVDEVLQVLRT
QKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDGRTRCSSVQEKLSQ
LKEKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFL
PIRRTMHLRRLKAEKMQELMRKQRQGPGPNTSLPAYGNVPSSGFYPASGG
SAPYPIMGPLMPMPPPSRPY*

LD45836.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Vps37B-PC 214 CG1115-PC 1..214 7..220 1097 100 Plus
Vps37B-PB 214 CG1115-PB 1..214 7..220 1097 100 Plus
Vps37B-PA 214 CG1115-PA 1..214 7..220 1097 100 Plus

LD45836.pep Sequence

Translation from 19 to 663

> LD45836.pep
MYQEYLYQLRATITPMCHEELKELLNDDDKLDEKVDEVLQVLRTQKTSVF
EDNRSRAERNIEREPQIIELRGQLAELSEDGRTRCSSVQEKLSQLKEKSG
GVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDAFLPIRRTM
HLRRLKAEKMQELMRKQRQGPGPNTSLPAYGNVPSSGFYPASGGSAPYPI
MGPLMPMPPPSRPY*

LD45836.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18928-PA 214 GF18928-PA 1..196 1..196 665 79.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12671-PA 213 GG12671-PA 1..197 1..198 885 87.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17720-PA 216 GH17720-PA 1..196 1..194 676 67.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Vps37B-PC 214 CG1115-PC 1..214 1..214 1097 100 Plus
Vps37B-PB 214 CG1115-PB 1..214 1..214 1097 100 Plus
Vps37B-PA 214 CG1115-PA 1..214 1..214 1097 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22540-PA 222 GI22540-PA 1..200 1..192 663 66.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21633-PA 226 GL21633-PA 1..205 1..202 745 70.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10797-PA 226 GA10797-PA 1..205 1..202 756 71.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10794-PA 214 GM10794-PA 1..214 1..214 1078 96.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19768-PA 214 GD19768-PA 1..214 1..214 1085 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10145-PA 223 GJ10145-PA 1..205 1..200 679 65.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12961-PA 221 GK12961-PA 1..196 1..192 631 67.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25454-PA 213 GE25454-PA 1..195 1..196 862 86.7 Plus