Clone LD45860 Report

Search the DGRC for LD45860

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:458
Well:60
Vector:pOT2
Associated Gene/TranscriptREG-RA
Protein status:LD45860.pep: gold
Preliminary Size:1502
Sequenced Size:1381

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1591 2001-01-01 Release 2 assignment
CG1591 2001-11-29 Blastp of sequenced clone
CG1591 2003-01-01 Sim4 clustering to Release 3
REG 2008-04-29 Release 5.5 accounting
REG 2008-08-15 Release 5.9 accounting
REG 2008-12-18 5.12 accounting

Clone Sequence Records

LD45860.complete Sequence

1381 bp (1381 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069688

> LD45860.complete
CACCACATGCGTGTTGTTGCTTGGGCATCAAAATTTGTCGACGGTCCGCG
TTGCTGATTGTTATTGAGAAGATAAGGAACGAGAAGAACCGGTACTACGC
CAGGAGACAGGACTCAGGATCAAAGGCTTCCACGGACACGAAAAGGAATC
CACATAGCTAACGAAATGCCTAACGACACTGTGGTAAAGGTGCAGGAGTA
CAAGGACTCGTTGATCCTCAAGGCAGAGCTGCTAATCACCAAGGGGTTCC
CGGAGAATATCGTCCGGCTGAACGAGCTGCTGGCCACGCCGATCTTCAAC
GAGCGCAACTTCGAAGAAGTGCACCAGGACCTCAACATCCCGGTCCTGCC
GCCTCTCCTGGTTAAAAACGAGTTGGAGGATCGTGACAGTCTGCCCACCA
AGCGCCAGCGCGTGGATGTCATCGTCTCTGGGCAGCCTGTCATGGGTCTG
CCCGCCGGTACAGTGCCGTGCAACAAGCCGCTCTGCGAGATGATCAAGGT
CGTCAAGCCTATCATCAGGAAGCTTGTGGAGGATTCCAATCTACTTAAGA
TGTGGATCTCCTTTATGATACCCAAGATCGAGGATGGCAACAACTTTGGC
GTCTCCATTCAAGAGGACACGCTTGCCGAAATTCAAACTGTGGAATCCGA
GGCGGCCGCCTTCTTTGACCAGATATCGCGCTATTTCTTGTCGCGCGCCA
AGGTGGTGTCCAAGGTGGCCAAGTATCCGCACATCGATGATTATCGGCGC
GCAGTCGTCGAACTTGACGAGAAGGAGTACCTCAGCTTGTGGCTGGTCGT
TTGTGAGGTCCGCAATCGCTACTCCTCGCTGCACGACATTGTTATTAAGA
ACCTCGAGAAGCTAAAGAAGCCGCGCTCCTCAAATACCGAAAGCCTGTAT
TAGGCTAGGTATTTCCGAAGCCCGAGCCTCAACTTTTTTTTTTCCTTTCC
ATCATCTTACTTTTCAATCAATAATCAGCCCGTAGAGCGGACGGTCAGCA
ATTCTTGTCGCTACTCAAAAAGCTAAGATTTTCCAATTCGGTTTACAAAC
ATCAAAATTCTTTAATTGAAGAGCAGTGATTGAACAATAGCTGTAGCCTA
ACTACCATCAACTATTAATCCATTTGTACTACGTCTAGAATGTAATGTTG
AGATTGGCGTACAATACAAGAAACCGATGCTGTATAGATTCCACTAATAG
CTATAGCTATGCATAAAAAGAATAGGCGAGCTCCATTGACACATTTTTTC
AACATTTCCTAATGTAAATTTATAACACGGGCGCCCCTCATACGGAAAAT
GTCCTTAAAAATGTGTGAAATATAAATCTTTATAAGTAATTCGCTCCGAA
TAGGTAAAAAAAAAAAAAAAAAAAAAAAAAA

LD45860.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
REG-RA 1896 REG-RA 147..1503 1..1357 6785 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13104033..13104852 536..1355 4070 99.8 Plus
chrX 22417052 chrX 13103339..13103834 40..535 2480 100 Plus
chrX 22417052 chrX 13103229..13103268 1..40 200 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13213156..13213977 536..1357 4110 100 Plus
X 23542271 X 13212463..13212958 40..535 2480 100 Plus
X 23542271 X 13212353..13212392 1..40 200 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13221254..13222075 536..1357 4110 100 Plus
X 23527363 X 13220561..13221056 40..535 2480 100 Plus
X 23527363 X 13220451..13220490 1..40 200 100 Plus
Blast to na_te.dros performed 2019-03-16 01:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 657..768 226..333 118 58.9 Plus

LD45860.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:38:24 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13103229..13103268 1..40 100 -> Plus
chrX 13103340..13103834 41..535 100 -> Plus
chrX 13104033..13104852 536..1355 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:29:20 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
REG-RA 1..738 166..903 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:21:53 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
REG-RA 1..738 166..903 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:39 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
REG-RA 1..738 166..903 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:48:14 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
REG-RA 1..738 166..903 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:38:21 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
REG-RA 1..738 166..903 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:56:21 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
REG-RA 21..1375 1..1355 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:21:53 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
REG-RA 21..1375 1..1355 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:39 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
REG-RA 16..1370 1..1355 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:48:14 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
REG-RA 21..1375 1..1355 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:38:21 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
REG-RA 16..1370 1..1355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:24 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
X 13212353..13212392 1..40 100 -> Plus
X 13212464..13212958 41..535 100 -> Plus
X 13213156..13213975 536..1355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:24 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
X 13212353..13212392 1..40 100 -> Plus
X 13212464..13212958 41..535 100 -> Plus
X 13213156..13213975 536..1355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:24 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
X 13212353..13212392 1..40 100 -> Plus
X 13212464..13212958 41..535 100 -> Plus
X 13213156..13213975 536..1355 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:39 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13106386..13106425 1..40 100 -> Plus
arm_X 13106497..13106991 41..535 100 -> Plus
arm_X 13107189..13108008 536..1355 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:24:43 Download gff for LD45860.complete
Subject Subject Range Query Range Percent Splice Strand
X 13220562..13221056 41..535 100 -> Plus
X 13221254..13222073 536..1355 100   Plus
X 13220451..13220490 1..40 100 -> Plus

LD45860.pep Sequence

Translation from 165 to 902

> LD45860.pep
MPNDTVVKVQEYKDSLILKAELLITKGFPENIVRLNELLATPIFNERNFE
EVHQDLNIPVLPPLLVKNELEDRDSLPTKRQRVDVIVSGQPVMGLPAGTV
PCNKPLCEMIKVVKPIIRKLVEDSNLLKMWISFMIPKIEDGNNFGVSIQE
DTLAEIQTVESEAAAFFDQISRYFLSRAKVVSKVAKYPHIDDYRRAVVEL
DEKEYLSLWLVVCEVRNRYSSLHDIVIKNLEKLKKPRSSNTESLY*

LD45860.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21408-PA 253 GF21408-PA 1..253 1..245 1157 88.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17763-PA 249 GG17763-PA 1..249 1..245 1188 92 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:35:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11898-PA 251 GH11898-PA 1..251 1..245 1085 83.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
REG-PB 245 CG1591-PB 1..245 1..245 1246 100 Plus
REG-PA 245 CG1591-PA 1..245 1..245 1246 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:35:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15909-PA 137 GI15909-PA 1..137 109..245 713 100 Plus
Dmoj\GI15908-PA 95 GI15908-PA 1..66 1..66 269 77.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13311-PA 247 GL13311-PA 1..247 1..245 1094 85.4 Plus
Dper\GL15090-PA 263 GL15090-PA 15..263 5..245 853 66.3 Plus
Dper\GL14290-PA 202 GL14290-PA 11..202 12..245 367 37 Plus
Dper\GL16040-PA 205 GL16040-PA 23..200 23..234 237 30.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14020-PA 247 GA14020-PA 1..247 1..245 1094 85.4 Plus
Dpse\GA25468-PA 263 GA25468-PA 15..263 5..245 850 65.9 Plus
Dpse\GA25043-PA 202 GA25043-PA 11..202 12..245 371 37.4 Plus
Dpse\GA26112-PA 205 GA26112-PA 23..200 23..234 228 28.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11610-PA 245 GM11610-PA 1..245 1..245 1241 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17109-PA 245 GD17109-PA 1..245 1..245 1243 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16817-PA 248 GJ16817-PA 1..248 1..245 1094 86.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18337-PA 255 GK18337-PA 1..255 1..245 1103 83.9 Plus
Dwil\GK22208-PA 231 GK22208-PA 1..231 1..245 596 48.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17053-PA 249 GE17053-PA 1..249 1..245 1184 91.6 Plus

LD45860.hyp Sequence

Translation from 165 to 902

> LD45860.hyp
MPNDTVVKVQEYKDSLILKAELLITKGFPENIVRLNELLATPIFNERNFE
EVHQDLNIPVLPPLLVKNELEDRDSLPTKRQRVDVIVSGQPVMGLPAGTV
PCNKPLCEMIKVVKPIIRKLVEDSNLLKMWISFMIPKIEDGNNFGVSIQE
DTLAEIQTVESEAAAFFDQISRYFLSRAKVVSKVAKYPHIDDYRRAVVEL
DEKEYLSLWLVVCEVRNRYSSLHDIVIKNLEKLKKPRSSNTESLY*

LD45860.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
REG-PB 245 CG1591-PB 1..245 1..245 1246 100 Plus
REG-PA 245 CG1591-PA 1..245 1..245 1246 100 Plus