Clone LD45889 Report

Search the DGRC for LD45889

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:458
Well:89
Vector:pOT2
Associated Gene/TranscriptPCNA-RA
Protein status:LD45889.pep: gold
Preliminary Size:1164
Sequenced Size:1051

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9193 2001-01-01 Release 2 assignment
CG9193 2002-06-13 Blastp of sequenced clone
CG9193 2003-01-01 Sim4 clustering to Release 3
mus209 2008-04-29 Release 5.5 accounting
mus209 2008-08-15 Release 5.9 accounting
mus209 2008-12-18 5.12 accounting

Clone Sequence Records

LD45889.complete Sequence

1051 bp (1051 high quality bases) assembled on 2002-06-13

GenBank Submission: AY122197

> LD45889.complete
TAAAAAAAAAAAACAGCCCACGTTAATCATTCATCCCAAAGTCACAGCCG
CGGTAACATTACTGCTGTTAAATTCTTAAGCCCGTCATCAGTATTTAAAT
AATAAAACACATTCAATATGTTCGAGGCACGCCTGGGTCAAGCCACCATC
CTGAAGAAGATCTTGGATGCCATCAAGGATCTGCTCAATGAGGCAACCTT
CGATTGCAGCGACTCCGGCATTCAGCTACAGGCCATGGACAACTCCCATG
TGTCGCTTGTCTCGCTGACCCTGCGTTCCGATGGCTTCGACAAGTTTCGC
TGCGACCGCAATCTCTCCATGGGCATGAATCTGGGCAGCATGGCCAAGAT
TCTGAAATGCGCCAACAACGAGGACAATGTGACGATGAAGGCGCAGGATA
ACGCCGACACTGTCACCATCATGTTCGAATCGGCTAACCAGGAGAAGGTA
TCGGACTACGAGATGAAACTGATGAACCTCGACCAGGAGCACCTGGGCAT
ACCGGAGACAGACTTCTCGTGCGTGGTCCGCATGCCGGCCATGGAGTTCG
CTCGCATCTGCCGCGATCTGGCGCAGTTCAGCGAATCCGTTGTGATCTGC
TGCACCAAGGAGGGCGTCAAGTTCTCGGCCAGCGGCGATGTGGGCACCGC
CAACATTAAGCTAGCCCAAACCGGCTCTGTCGACAAGGAGGAGGAGGCGG
TGATCATCGAGATGCAGGAGCCGGTGACGCTGACATTTGCCTGTCGCTAC
CTGAACGCCTTCACAAAGGCGACGCCATTGTCCACCCAAGTGCAGCTGTC
GATGTGCGCAGATGTTCCGCTGGTAGTCGAGTATGCGATCAAGGATCTGG
GTCACATTCGCTACTACCTGGCACCCAAGATCGAGGACAACGAGACATAA
GTCAGCTGTGTTCCTCATATTTATGTCCCCGCATCGTCACCACTCATCTT
CCCACGTTCACTTCATTCCTAACTTTTAAGTAAATCCGCATTTTTTGATC
AATAAAAGCTATACTGTGTAATGTTAAAAAAAAAAAAAAAAAAAAAAAAA
A

LD45889.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
mus209-RB 1118 mus209-RB 46..1072 1..1027 5135 100 Plus
mus209-RA 1118 mus209-RA 46..1072 1..1027 5135 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16148791..16149593 1025..223 3940 99.4 Minus
chr2R 21145070 chr2R 16149651..16149875 225..1 1095 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20261752..20262556 1027..223 4025 100 Minus
2R 25286936 2R 20262614..20262838 225..1 1125 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20262951..20263755 1027..223 4025 100 Minus
2R 25260384 2R 20263813..20264037 225..1 1125 100 Minus
Blast to na_te.dros performed on 2019-03-15 13:53:16 has no hits.

LD45889.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:54:24 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16148791..16149590 226..1025 99 <- Minus
chr2R 16149651..16149875 1..225 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:29:25 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
mus209-RA 1..783 118..900 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:21:30 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
mus209-RA 1..783 118..900 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:15:33 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
mus209-RB 1..783 118..900 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:12:20 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
mus209-RA 1..783 118..900 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:43:37 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
PCNA-RB 1..783 118..900 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:47:40 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
mus209-RA 20..1044 1..1025 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:21:29 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
mus209-RA 20..1044 1..1025 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:15:33 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
mus209-RA 46..1070 1..1025 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:12:21 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
mus209-RA 20..1044 1..1025 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:43:37 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
PCNA-RA 46..1070 1..1025 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:54:24 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20261754..20262553 226..1025 100 <- Minus
2R 20262614..20262838 1..225 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:54:24 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20261754..20262553 226..1025 100 <- Minus
2R 20262614..20262838 1..225 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:54:24 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20261754..20262553 226..1025 100 <- Minus
2R 20262614..20262838 1..225 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:15:33 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16149259..16150058 226..1025 100 <- Minus
arm_2R 16150119..16150343 1..225 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:45:00 Download gff for LD45889.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20262953..20263752 226..1025 100 <- Minus
2R 20263813..20264037 1..225 100   Minus

LD45889.pep Sequence

Translation from 117 to 899

> LD45889.pep
MFEARLGQATILKKILDAIKDLLNEATFDCSDSGIQLQAMDNSHVSLVSL
TLRSDGFDKFRCDRNLSMGMNLGSMAKILKCANNEDNVTMKAQDNADTVT
IMFESANQEKVSDYEMKLMNLDQEHLGIPETDFSCVVRMPAMEFARICRD
LAQFSESVVICCTKEGVKFSASGDVGTANIKLAQTGSVDKEEEAVIIEMQ
EPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYY
LAPKIEDNET*

LD45889.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\mus209-PA 260 GF12678-PA 1..260 1..260 1386 100 Plus
Dana\GF15480-PA 255 GF15480-PA 1..252 1..257 879 58.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\mus209-PA 260 GG20875-PA 1..260 1..260 1386 100 Plus
Dere\GG21617-PA 255 GG21617-PA 1..255 1..260 872 58.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22744-PA 260 GH22744-PA 1..260 1..260 1374 98.8 Plus
Dgri\GH13054-PA 254 GH13054-PA 1..252 1..257 878 59.5 Plus
Dgri\GH23444-PA 254 GH23444-PA 1..252 1..257 877 59.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
PCNA-PA 260 CG9193-PA 1..260 1..260 1324 100 Plus
PCNA-PB 260 CG9193-PB 1..260 1..260 1324 100 Plus
PCNA2-PA 255 CG10262-PA 1..252 1..257 788 55.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18526-PA 260 GI18526-PA 1..260 1..260 1362 97.7 Plus
Dmoj\GI18198-PA 255 GI18198-PA 1..255 1..260 910 61.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17573-PA 260 GL17573-PA 1..260 1..260 1371 98.5 Plus
Dper\GL26136-PA 255 GL26136-PA 1..252 1..257 866 56.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21602-PA 260 GA21602-PA 1..260 1..260 1371 98.5 Plus
Dpse\GA10201-PA 255 GA10201-PA 1..252 1..257 866 56.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\mus209-PA 260 GM19799-PA 1..260 1..260 1383 99.6 Plus
Dsec\GM16995-PA 255 GM16995-PA 1..252 1..257 822 56 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\mus209-PA 260 GD25292-PA 1..260 1..260 1383 99.6 Plus
Dsim\GD21742-PA 255 GD21742-PA 1..252 1..257 823 55.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\mus209-PA 260 GJ21392-PA 1..260 1..260 1361 97.7 Plus
Dvir\GJ14692-PA 259 GJ14692-PA 1..259 1..260 909 61 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\mus209-PA 260 GK15676-PA 1..260 1..260 1342 95.8 Plus
Dwil\GK15224-PA 255 GK15224-PA 1..252 1..257 890 59.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\mus209-PA 260 GE13815-PA 1..260 1..260 1386 100 Plus
Dyak\GE12637-PA 255 GE12637-PA 1..255 1..260 879 58.5 Plus

LD45889.hyp Sequence

Translation from 117 to 899

> LD45889.hyp
MFEARLGQATILKKILDAIKDLLNEATFDCSDSGIQLQAMDNSHVSLVSL
TLRSDGFDKFRCDRNLSMGMNLGSMAKILKCANNEDNVTMKAQDNADTVT
IMFESANQEKVSDYEMKLMNLDQEHLGIPETDFSCVVRMPAMEFARICRD
LAQFSESVVICCTKEGVKFSASGDVGTANIKLAQTGSVDKEEEAVIIEMQ
EPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYY
LAPKIEDNET*

LD45889.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
PCNA-PA 260 CG9193-PA 1..260 1..260 1324 100 Plus
PCNA-PB 260 CG9193-PB 1..260 1..260 1324 100 Plus
CG10262-PA 255 CG10262-PA 1..252 1..257 788 55.3 Plus