Clone LD46144 Report

Search the DGRC for LD46144

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:461
Well:44
Vector:pOT2
Associated Gene/TranscriptCG1307-RC
Protein status:LD46144.pep: gold
Preliminary Size:1052
Sequenced Size:887

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1307 2001-01-01 Release 2 assignment
CG1307 2002-06-12 Blastp of sequenced clone
CG1307 2003-01-01 Sim4 clustering to Release 3
CG1307 2008-04-29 Release 5.5 accounting
CG1307 2008-08-15 Release 5.9 accounting
CG1307 2008-12-18 5.12 accounting

Clone Sequence Records

LD46144.complete Sequence

887 bp (887 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122198

> LD46144.complete
CCGCAAGCGAAAACGTGAAGTGAGCGCCATCGGTGGTGTTTTCTCGCGAA
ATATAATATCAACTAAGCGGAGAAAGATGGGCGACAAGTTGCTGGATCCG
ACGCAGATCATCAATGGGCTGGCTGTGATGCTGTCCTTTTTCGTGGGCTA
CCGATACGCCCTGAAGCGAGGCGATGCCAAGGACTCCGTCACCGAGGGAG
CGGCGACCCCGTTCTCGCAGGAATCTTCGGTGTCTAGCGGTTCCGAGGCT
TCAGTTTCGGATAAGGGCTATGGAGGCTTGAACGACAACTTTAAGATGGT
CCTGGTGGTGCGCAACGATCTCAAGATGGGCAAGGGCAAAATTGCCGCCC
AGTGTGGCCACGGAGCGGTGGGTGCTTACCAGCGGGCGGTGGTCAGGACG
CCTCGACTACTGCGGTCGTGGGAGAACTGCGGTTGCGCCAAGATAGCCGT
TCGCGTGGAGAGCGAGGCGGAGCTGATGGCCATCAAGAAGGAGGCCGAGA
GACAGCAACTGAACACGTGTCTCATCCGCGACGCCGGTCGCACACAAATA
GAGGCCAACTCCAAGACTGTGCTGGCCGTGGGTCCAGCGGCTGCCGCCGA
CATCGACCGGGTTACCGGCCACCTGAAATTGCTGTAAGATCCGCACTTCG
GAAACTCTCACAGGCCATTGGCATTACTAATTCACTCAAGTGCAACCCGA
CAATTCACAAAGCAATACGGCGCACCGGTGGAGCGGTTGAAAGATTAAGG
CCACCGGGTGGAGGACGACTGTGACATGCAAGCTAAGCTAAGATTTACGT
TATTACATTAACTGTGAACCGAGCTATTAAACATTAAACGATTGACAGTC
CGGCCTGGAACTGCAAAGCAAAAAAAAAAAAAAAAAA

LD46144.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:47:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG1307.a 1259 CG1307.a 131..999 1..869 4345 100 Plus
CG1307-RC 1273 CG1307-RC 145..1013 1..869 4345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2482092..2482697 869..264 3030 100 Minus
chr3R 27901430 chr3R 2482949..2483214 266..1 1330 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6656290..6656895 869..264 3030 100 Minus
3R 32079331 3R 6657147..6657412 266..1 1330 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6397121..6397726 869..264 3030 100 Minus
3R 31820162 3R 6397978..6398243 266..1 1330 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:36:12 has no hits.

LD46144.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:37:07 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2482092..2482695 266..869 100 <- Minus
chr3R 2482950..2483214 1..265 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:29:37 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
CG1307-RB 1..561 77..637 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:22:23 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
CG1307-RC 1..561 77..637 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:09:04 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
CG1307-RC 1..561 77..637 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:13:08 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
CG1307-RB 1..561 77..637 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:07:39 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
CG1307-RC 1..561 77..637 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:49:03 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
CG1307-RB 102..970 1..869 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:22:23 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
CG1307-RC 75..943 1..869 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:09:04 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
CG1307-RC 31..899 1..869 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:13:08 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
CG1307-RB 102..970 1..869 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:07:39 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
CG1307-RC 31..899 1..869 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:37:07 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6656290..6656893 266..869 100 <- Minus
3R 6657148..6657412 1..265 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:37:07 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6656290..6656893 266..869 100 <- Minus
3R 6657148..6657412 1..265 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:37:07 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6656290..6656893 266..869 100 <- Minus
3R 6657148..6657412 1..265 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:09:04 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2482870..2483134 1..265 100   Minus
arm_3R 2482012..2482615 266..869 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:45:55 Download gff for LD46144.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6397121..6397724 266..869 100 <- Minus
3R 6397979..6398243 1..265 100   Minus

LD46144.hyp Sequence

Translation from 0 to 636

> LD46144.hyp
RKRKREVSAIGGVFSRNIISTKRRKMGDKLLDPTQIINGLAVMLSFFVGY
RYALKRGDAKDSVTEGAATPFSQESSVSSGSEASVSDKGYGGLNDNFKMV
LVVRNDLKMGKGKIAAQCGHGAVGAYQRAVVRTPRLLRSWENCGCAKIAV
RVESEAELMAIKKEAERQQLNTCLIRDAGRTQIEANSKTVLAVGPAAAAD
IDRVTGHLKLL*

LD46144.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG1307-PE 186 CG1307-PE 1..186 26..211 936 100 Plus
CG1307-PD 186 CG1307-PD 1..186 26..211 936 100 Plus
CG1307-PC 186 CG1307-PC 1..186 26..211 936 100 Plus
CG17327-PC 139 CG17327-PC 23..139 98..211 269 47 Plus
CG17327-PA 139 CG17327-PA 23..139 98..211 269 47 Plus

LD46144.pep Sequence

Translation from 76 to 636

> LD46144.pep
MGDKLLDPTQIINGLAVMLSFFVGYRYALKRGDAKDSVTEGAATPFSQES
SVSSGSEASVSDKGYGGLNDNFKMVLVVRNDLKMGKGKIAAQCGHGAVGA
YQRAVVRTPRLLRSWENCGCAKIAVRVESEAELMAIKKEAERQQLNTCLI
RDAGRTQIEANSKTVLAVGPAAAADIDRVTGHLKLL*

LD46144.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17805-PA 182 GF17805-PA 1..182 1..186 803 82.8 Plus
Dana\GF13823-PA 139 GF13823-PA 23..139 73..186 253 45.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10346-PA 186 GG10346-PA 1..186 1..186 834 93.5 Plus
Dere\GG17084-PA 139 GG17084-PA 23..139 73..186 271 46.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19492-PA 182 GH19492-PA 1..182 1..186 742 75.8 Plus
Dgri\GH20957-PA 128 GH20957-PA 12..128 73..186 267 47.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG1307-PE 186 CG1307-PE 1..186 1..186 936 100 Plus
CG1307-PC 186 CG1307-PC 1..186 1..186 936 100 Plus
CG17327-PC 139 CG17327-PC 23..139 73..186 269 47 Plus
CG17327-PA 139 CG17327-PA 23..139 73..186 269 47 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23763-PA 179 GI23763-PA 1..179 1..186 749 76.9 Plus
Dmoj\GI21294-PA 189 GI21294-PA 58..189 63..186 273 43.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22055-PA 181 GL22055-PA 1..181 1..186 772 79.6 Plus
Dper\GL11078-PA 132 GL11078-PA 16..132 73..186 264 47 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12019-PA 181 GA12019-PA 1..181 1..186 770 79.6 Plus
Dpse\GA24602-PA 132 GA24602-PA 16..132 73..186 264 47 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10538-PA 186 GM10538-PA 1..186 1..186 943 96.2 Plus
Dsec\GM25967-PA 185 GM25967-PA 69..185 73..186 264 46.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19535-PA 186 GD19535-PA 1..186 1..186 943 96.2 Plus
Dsim\GD20527-PA 193 GD20527-PA 77..193 73..186 265 46.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23946-PA 167 GJ23946-PA 1..167 1..186 560 63.4 Plus
Dvir\GJ20896-PA 183 GJ20896-PA 67..183 73..186 271 49.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10837-PA 187 GK10837-PA 1..187 1..186 691 70.9 Plus
Dwil\GK22001-PA 176 GK22001-PA 60..176 73..186 250 45.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25841-PA 186 GE25841-PA 1..186 1..186 877 90.3 Plus
Dyak\GE24473-PA 193 GE24473-PA 77..193 73..186 267 46.2 Plus