Clone LD46156 Report

Search the DGRC for LD46156

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:461
Well:56
Vector:pOT2
Associated Gene/TranscriptCG10527-RA
Protein status:LD46156.pep: gold
Preliminary Size:1269
Sequenced Size:1161

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10527 2001-01-01 Release 2 assignment
CG10527 2002-06-12 Blastp of sequenced clone
CG10527 2003-01-01 Sim4 clustering to Release 3
CG10527 2008-04-29 Release 5.5 accounting
CG10527 2008-08-15 Release 5.9 accounting
CG10527 2008-12-18 5.12 accounting

Clone Sequence Records

LD46156.complete Sequence

1161 bp (1161 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122199

> LD46156.complete
TCTCAGTAAGCGAACATCGTTGATTGAAACAGCAATCATGCCAATCGAAG
TCAACACCCCCGATAAGTTGGAGTACCAATTCTTCCCCGCCAGCGGTGGA
GTTTTTACCTTCAAGGTGCGTTCCCCCAAGGATGCTCATTTGGCACTCAC
ACCCGCGCCCGAGGAGAACGGTCCCATTTTCGAGATCTTTCTGGGAGGAT
GGGAGAACACCAAGTCGGTGATCCGCAAGGACCGCCAGAAGCCCGAAGTC
GCTGAGGTGCCCACTCCGGGCATCCTAGATGCCGGAGAGTTCCGTGGCTT
CTGGGTGCGCTGGTACGACAATGTCATCACCGTTGGCCGCGAAGGAGACG
CCGCCGCCTTCCTTTCCTACGATGCTGGTAGCCTGTTCCCGGTCAACTTC
GTCGGCATCTGCACGGGATGGGGTGCCAGCGGCACCTGGCTGATTGATGA
GCCCGCTCCATCGGCTCCCGTCATGGGCTTCGCCGCGCCCACAGGAAGCG
GACCAGGATGCTGGGTGCCCGCCGCCAACGGTGAGGTGCCACCCAACGCC
CTCGAGGGAGGATTCGACAGCAGCGAGCAGCTGTACATCGCCCGTGCCCG
CCATGAGGGCGACCTCATTCCCGGCAAGCTGCATCCCTCCCACGGAGTGA
CCTACGTAGCCTGGGGAGGTGGTGAGCACGGCCACGCCGAATACGAGGTG
CTGTGCGCCGGCGGCGGCCAGTGGTTGCCCGTGGATGCCGGAAACATCCC
GCCCAACGCCCTGCCTGCCGGAGAGACCGCCGAGGGCGAACCACTGTTCA
TCGGCCGTGCCACCCACGACGGAACTATCACTGTGGGCAAGGTGCAGCCC
TCCCACGGATGCTGCTACATTCCGTACGGCGGCGAGGAGCTGGCCTACAA
GGAGTTCGAAATCTATGTGACCAACTAAGCCACGGATCGAATGTCCAACG
CACTGAAACAAAACGTTTTAAATCAGTTAATCTGAGCGCTTTACAGTTCA
ACTGGTCGCAGAAATTTTATTTTATTTATATGTGCATTTCTACTCAAAAC
TGTTAAAGAATCTCTATATTATGTCGAAAAGTTTATTACATTGTTCAACG
AAATTGGTTAATAAACAATAAATATGTTTAAGAAAATAACATAAAAAAAA
AAAAAAAAAAA

LD46156.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG10527-RA 1510 CG10527-RA 64..1206 1..1143 5715 100 Plus
CG10527.a 1466 CG10527.a 23..1162 1..1143 5645 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16956829..16957522 1142..449 3350 98.8 Minus
chr2R 21145070 chr2R 16957863..16958265 449..47 1970 99.3 Minus
chr2R 21145070 chr2R 16959191..16959237 47..1 235 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21070367..21071061 1143..449 3475 100 Minus
2R 25286936 2R 21071402..21071804 449..47 2015 100 Minus
2R 25286936 2R 21072725..21072771 47..1 235 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21071566..21072260 1143..449 3475 100 Minus
2R 25260384 2R 21072601..21073003 449..47 2015 100 Minus
2R 25260384 2R 21073924..21073970 47..1 235 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:08:49 has no hits.

LD46156.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:10:01 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16956829..16957521 450..1142 98 <- Minus
chr2R 16957863..16958264 48..449 99 <- Minus
chr2R 16959191..16959237 1..47 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:29:38 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
CG10527-RA 1..891 38..928 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:23:03 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
CG10527-RA 1..891 38..928 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:00:18 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
CG10527-RA 1..891 38..928 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:13:45 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
CG10527-RA 1..891 38..928 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:28:21 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
CG10527-RA 1..891 38..928 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:50:00 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
CG10527-RA 15..1156 1..1142 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:23:02 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
CG10527-RA 15..1156 1..1142 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:00:18 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
CG10527-RA 19..1160 1..1142 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:13:46 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
CG10527-RA 15..1156 1..1142 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:28:21 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
CG10527-RA 19..1160 1..1142 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:01 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21070368..21071060 450..1142 100 <- Minus
2R 21071402..21071803 48..449 100 <- Minus
2R 21072725..21072771 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:01 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21070368..21071060 450..1142 100 <- Minus
2R 21071402..21071803 48..449 100 <- Minus
2R 21072725..21072771 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:01 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21070368..21071060 450..1142 100 <- Minus
2R 21071402..21071803 48..449 100 <- Minus
2R 21072725..21072771 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:00:18 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16957873..16958565 450..1142 100 <- Minus
arm_2R 16958907..16959308 48..449 100 <- Minus
arm_2R 16960230..16960276 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:46:37 Download gff for LD46156.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21071567..21072259 450..1142 100 <- Minus
2R 21072601..21073002 48..449 100 <- Minus
2R 21073924..21073970 1..47 100   Minus

LD46156.hyp Sequence

Translation from 0 to 927

> LD46156.hyp
LSKRTSLIETAIMPIEVNTPDKLEYQFFPASGGVFTFKVRSPKDAHLALT
PAPEENGPIFEIFLGGWENTKSVIRKDRQKPEVAEVPTPGILDAGEFRGF
WVRWYDNVITVGREGDAAAFLSYDAGSLFPVNFVGICTGWGASGTWLIDE
PAPSAPVMGFAAPTGSGPGCWVPAANGEVPPNALEGGFDSSEQLYIARAR
HEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAGGGQWLPVDAGNIP
PNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYK
EFEIYVTN*

LD46156.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG10527-PA 296 CG10527-PA 1..296 13..308 1632 100 Plus
CG44250-PC 297 CG44250-PC 1..153 158..306 362 45.1 Plus
CG44250-PB 286 CG44250-PB 14..142 179..306 360 48.8 Plus
CG13321-PB 286 CG13321-PB 145..284 168..306 340 44.3 Plus
CG13321-PA 286 CG13321-PA 145..284 168..306 340 44.3 Plus
CG13321-PB 286 CG13321-PB 13..143 177..306 324 42.7 Plus
CG13321-PB 286 CG13321-PB 78..211 171..304 292 39.3 Plus
CG44250-PC 297 CG44250-PC 160..293 171..304 283 42.2 Plus
CG44250-PB 286 CG44250-PB 149..282 171..304 283 42.2 Plus
CG44250-PB 286 CG44250-PB 77..212 171..304 276 40.4 Plus

LD46156.pep Sequence

Translation from 37 to 927

> LD46156.pep
MPIEVNTPDKLEYQFFPASGGVFTFKVRSPKDAHLALTPAPEENGPIFEI
FLGGWENTKSVIRKDRQKPEVAEVPTPGILDAGEFRGFWVRWYDNVITVG
REGDAAAFLSYDAGSLFPVNFVGICTGWGASGTWLIDEPAPSAPVMGFAA
PTGSGPGCWVPAANGEVPPNALEGGFDSSEQLYIARARHEGDLIPGKLHP
SHGVTYVAWGGGEHGHAEYEVLCAGGGQWLPVDAGNIPPNALPAGETAEG
EPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEIYVTN*

LD46156.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12982-PA 295 GF12982-PA 1..294 1..294 1400 91.5 Plus
Dana\GF22376-PA 285 GF22376-PA 127..283 139..294 319 39.5 Plus
Dana\GF12932-PA 287 GF12932-PA 145..285 156..294 318 46.1 Plus
Dana\GF23006-PA 143 GF23006-PA 4..143 159..296 297 42.1 Plus
Dana\GF12932-PA 287 GF12932-PA 13..143 165..294 294 45.8 Plus
Dana\GF21233-PA 272 GF21233-PA 132..270 158..294 293 39.6 Plus
Dana\GF22376-PA 285 GF22376-PA 6..140 159..292 291 42.2 Plus
Dana\GF12932-PA 287 GF12932-PA 78..212 159..292 258 42.6 Plus
Dana\GF21233-PA 272 GF21233-PA 10..199 143..294 215 30 Plus
Dana\GF22376-PA 285 GF22376-PA 77..210 159..292 207 37 Plus
Dana\GF12982-PA 295 GF12982-PA 224..295 154..224 161 48.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20806-PA 296 GG20806-PA 1..296 1..296 1511 97 Plus
Dere\GG22534-PA 286 GG22534-PA 5..144 159..296 332 45.7 Plus
Dere\GG20349-PA 286 GG20349-PA 145..285 156..295 317 45.4 Plus
Dere\GG17790-PA 285 GG17790-PA 6..140 159..292 297 43.7 Plus
Dere\GG20349-PA 286 GG20349-PA 13..143 165..294 296 43.5 Plus
Dere\GG17790-PA 285 GG17790-PA 127..283 139..294 286 40.1 Plus
Dere\GG11468-PA 148 GG11468-PA 6..140 159..292 284 41.5 Plus
Dere\GG20349-PA 286 GG20349-PA 78..211 159..292 257 39.3 Plus
Dere\GG22534-PA 286 GG22534-PA 149..282 159..292 255 41.5 Plus
Dere\GG17790-PA 285 GG17790-PA 77..189 159..271 204 41.2 Plus
Dere\GG11468-PA 148 GG11468-PA 77..141 159..222 141 49.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20464-PA 304 GH20464-PA 1..304 1..296 1366 84.9 Plus
Dgri\GH21600-PA 287 GH21600-PA 14..142 167..294 310 46.5 Plus
Dgri\GH23671-PA 272 GH23671-PA 131..272 156..296 305 40.8 Plus
Dgri\GH20307-PA 285 GH20307-PA 144..285 156..296 305 40.8 Plus
Dgri\GH23671-PA 272 GH23671-PA 1..129 167..294 300 46.5 Plus
Dgri\GH23671-PA 272 GH23671-PA 63..197 158..292 299 44.9 Plus
Dgri\GH20307-PA 285 GH20307-PA 14..142 167..294 298 45.7 Plus
Dgri\GH20307-PA 285 GH20307-PA 76..210 158..292 298 44.9 Plus
Dgri\GH19468-PA 146 GH19468-PA 6..140 159..292 290 42.2 Plus
Dgri\GH21600-PA 287 GH21600-PA 149..283 159..292 263 40.7 Plus
Dgri\GH21600-PA 287 GH21600-PA 77..212 159..292 241 39.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG10527-PA 296 CG10527-PA 1..296 1..296 1632 100 Plus
CG44250-PC 297 CG44250-PC 1..153 146..294 362 45.1 Plus
CG44250-PB 286 CG44250-PB 14..142 167..294 360 48.8 Plus
CG13321-PB 286 CG13321-PB 145..284 156..294 340 44.3 Plus
CG13321-PA 286 CG13321-PA 145..284 156..294 340 44.3 Plus
CG32633-PB 285 CG32633-PB 127..283 139..294 326 38.9 Plus
CG32633-PA 285 CG32633-PA 127..283 139..294 326 38.9 Plus
CG13321-PB 286 CG13321-PB 13..143 165..294 324 42.7 Plus
CG13321-PA 286 CG13321-PA 13..143 165..294 324 42.7 Plus
CG32633-PB 285 CG32633-PB 6..140 159..292 313 42.2 Plus
CG32633-PA 285 CG32633-PA 6..140 159..292 313 42.2 Plus
CG31086-PB 148 CG31086-PB 6..140 159..292 301 41.5 Plus
CG31086-PA 148 CG31086-PA 6..140 159..292 301 41.5 Plus
CG13321-PB 286 CG13321-PB 78..211 159..292 292 39.3 Plus
CG13321-PA 286 CG13321-PA 78..211 159..292 292 39.3 Plus
CG44250-PC 297 CG44250-PC 160..293 159..292 283 42.2 Plus
CG44250-PB 286 CG44250-PB 149..282 159..292 283 42.2 Plus
CG44250-PB 286 CG44250-PB 77..212 159..292 276 40.4 Plus
CG44251-PB 450 CG44251-PB 280..435 142..294 265 39.1 Plus
CG44251-PA 478 CG44251-PA 308..463 142..294 265 39.1 Plus
CG32633-PB 285 CG32633-PB 77..202 159..284 239 40.2 Plus
CG32633-PA 285 CG32633-PA 77..202 159..284 239 40.2 Plus
CG44251-PA 478 CG44251-PA 5..142 159..294 192 31.9 Plus
CG44251-PB 450 CG44251-PB 2..114 182..294 175 31.9 Plus
CG10916-PB 263 CG10916-PB 140..254 183..294 151 30.8 Plus
CG10916-PA 263 CG10916-PA 140..254 183..294 151 30.8 Plus
CG31086-PB 148 CG31086-PB 77..141 159..222 148 47.7 Plus
CG31086-PA 148 CG31086-PA 77..141 159..222 148 47.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18889-PA 296 GI18889-PA 1..296 1..296 1429 91.2 Plus
Dmoj\GI19977-PA 285 GI19977-PA 76..210 158..292 311 46.3 Plus
Dmoj\GI19977-PA 285 GI19977-PA 14..142 167..294 305 45.7 Plus
Dmoj\GI19569-PA 286 GI19569-PA 14..142 167..294 303 45 Plus
Dmoj\GI19977-PA 285 GI19977-PA 144..285 156..296 298 40.8 Plus
Dmoj\GI24703-PA 159 GI24703-PA 6..139 159..291 274 42.5 Plus
Dmoj\GI19570-PA 480 GI19570-PA 328..467 159..296 261 41.4 Plus
Dmoj\GI19569-PA 286 GI19569-PA 149..282 159..292 259 40 Plus
Dmoj\GI19569-PA 286 GI19569-PA 77..212 159..292 236 39.7 Plus
Dmoj\GI19570-PA 480 GI19570-PA 7..144 159..294 204 32.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10179-PA 301 GL10179-PA 30..301 25..296 1276 91.5 Plus
Dper\GL11485-PA 285 GL11485-PA 144..283 156..294 346 45.7 Plus
Dper\GL11485-PA 285 GL11485-PA 13..142 166..294 303 44.6 Plus
Dper\GL21834-PA 148 GL21834-PA 6..140 159..292 284 42.2 Plus
Dper\GL11485-PA 285 GL11485-PA 77..210 159..292 270 42.2 Plus
Dper\GL10596-PA 436 GL10596-PA 251..423 128..296 234 38.9 Plus
Dper\GL10595-PA 109 GL10595-PA 2..105 189..292 226 41.3 Plus
Dper\GL10596-PA 436 GL10596-PA 1..114 181..294 162 29.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10372-PA 296 GA10372-PA 1..296 1..296 1396 91.9 Plus
Dpse\GA24742-PA 285 GA24742-PA 144..283 156..294 347 45.7 Plus
Dpse\GA17750-PA 287 GA17750-PA 14..142 167..294 332 48.1 Plus
Dpse\GA24742-PA 285 GA24742-PA 13..142 166..294 302 44.6 Plus
Dpse\GA15997-PA 148 GA15997-PA 6..140 159..292 286 42.2 Plus
Dpse\GA17750-PA 287 GA17750-PA 149..283 159..292 271 40.7 Plus
Dpse\GA24742-PA 285 GA24742-PA 77..210 159..292 270 42.2 Plus
Dpse\GA17750-PA 287 GA17750-PA 77..212 159..292 252 41.2 Plus
Dpse\GA24420-PA 444 GA24420-PA 286..431 154..296 233 40.4 Plus
Dpse\GA24420-PA 444 GA24420-PA 1..114 181..294 169 30.7 Plus
Dpse\GA24742-PA 285 GA24742-PA 218..285 159..225 147 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15752-PA 296 GM15752-PA 1..296 1..296 1525 98 Plus
Dsec\GM20320-PA 297 GM20320-PA 16..155 159..296 339 46.4 Plus
Dsec\GM21436-PA 286 GM21436-PA 145..285 156..295 318 45.4 Plus
Dsec\GM21436-PA 286 GM21436-PA 13..143 165..294 291 42 Plus
Dsec\GM17616-PA 285 GM17616-PA 127..283 139..294 279 38.9 Plus
Dsec\GM17616-PA 285 GM17616-PA 6..140 159..292 276 40.7 Plus
Dsec\GM20320-PA 297 GM20320-PA 160..293 159..292 259 43 Plus
Dsec\GM21436-PA 286 GM21436-PA 78..211 159..292 255 38.5 Plus
Dsec\GM10313-PA 108 GM10313-PA 1..100 193..292 237 44 Plus
Dsec\GM17616-PA 285 GM17616-PA 77..189 159..271 190 39.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25227-PA 151 GD25227-PA 1..151 146..296 777 98 Plus
Dsim\GD25797-PA 642 GD25797-PA 5..144 159..296 340 46.4 Plus
Dsim\GD10934-PA 286 GD10934-PA 145..285 156..295 320 45.4 Plus
Dsim\GD24809-PA 285 GD24809-PA 6..140 159..292 303 43 Plus
Dsim\GD10934-PA 286 GD10934-PA 13..143 165..294 292 42 Plus
Dsim\GD24809-PA 285 GD24809-PA 127..283 139..294 283 38.9 Plus
Dsim\GD21274-PA 148 GD21274-PA 6..140 159..292 281 40.7 Plus
Dsim\GD10934-PA 286 GD10934-PA 78..211 159..292 257 38.5 Plus
Dsim\GD25797-PA 642 GD25797-PA 77..212 159..292 253 40.4 Plus
Dsim\GD25797-PA 642 GD25797-PA 149..274 159..288 236 43.5 Plus
Dsim\GD24809-PA 285 GD24809-PA 77..189 159..271 211 42.1 Plus
Dsim\GD25797-PA 642 GD25797-PA 275..412 159..294 185 31.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21924-PA 296 GJ21924-PA 1..296 1..296 1410 89.2 Plus
Dvir\GJ19513-PA 285 GJ19513-PA 127..283 139..294 326 40.8 Plus
Dvir\GJ21230-PA 285 GJ21230-PA 76..210 158..292 312 46.3 Plus
Dvir\GJ21230-PA 285 GJ21230-PA 14..142 167..294 303 45.7 Plus
Dvir\GJ19513-PA 285 GJ19513-PA 6..140 159..292 294 43.7 Plus
Dvir\GJ21230-PA 285 GJ21230-PA 144..285 156..296 294 39.4 Plus
Dvir\GJ23921-PA 146 GJ23921-PA 5..140 158..292 287 41.9 Plus
Dvir\GJ21145-PA 459 GJ21145-PA 287..446 140..296 284 43.1 Plus
Dvir\GJ19513-PA 285 GJ19513-PA 77..212 159..294 222 36.5 Plus
Dvir\GJ21145-PA 459 GJ21145-PA 1..114 181..294 166 30.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23270-PA 296 GK23270-PA 1..296 1..296 1411 88.5 Plus
Dwil\GK20087-PA 285 GK20087-PA 127..283 139..294 334 43.3 Plus
Dwil\GK20869-PA 143 GK20869-PA 2..143 157..296 323 43.7 Plus
Dwil\GK20873-PA 420 GK20873-PA 147..275 167..294 311 46.5 Plus
Dwil\GK20771-PA 340 GK20771-PA 199..340 156..296 306 39.4 Plus
Dwil\GK20873-PA 420 GK20873-PA 1..135 163..296 301 44.4 Plus
Dwil\GK20087-PA 285 GK20087-PA 6..140 159..292 295 43 Plus
Dwil\GK20771-PA 340 GK20771-PA 69..197 167..294 294 45 Plus
Dwil\GK20771-PA 340 GK20771-PA 132..265 159..292 279 43.7 Plus
Dwil\GK20873-PA 420 GK20873-PA 282..416 159..292 277 43 Plus
Dwil\GK20873-PA 420 GK20873-PA 210..345 159..292 248 40.4 Plus
Dwil\GK20087-PA 285 GK20087-PA 77..212 159..294 227 38 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13745-PA 296 GE13745-PA 1..296 1..296 1519 98 Plus
Dyak\GE13405-PA 287 GE13405-PA 6..145 159..296 330 45.7 Plus
Dyak\GE12508-PA 286 GE12508-PA 145..285 156..295 320 46.1 Plus
Dyak\GE17086-PA 285 GE17086-PA 6..140 159..292 303 43 Plus
Dyak\GE12508-PA 286 GE12508-PA 13..143 165..294 291 42.7 Plus
Dyak\GE17086-PA 285 GE17086-PA 127..283 139..294 282 38.9 Plus
Dyak\GE23659-PA 148 GE23659-PA 6..140 159..292 282 40.7 Plus
Dyak\GE12508-PA 286 GE12508-PA 78..211 159..292 259 40.7 Plus
Dyak\GE13405-PA 287 GE13405-PA 150..283 159..292 256 42.2 Plus
Dyak\GE17086-PA 285 GE17086-PA 77..189 159..271 199 40.4 Plus