Clone LD46221 Report

Search the DGRC for LD46221

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:462
Well:21
Vector:pOT2
Associated Gene/TranscriptCG10916-RA
Protein status:LD46221.pep: gold
Preliminary Size:1096
Sequenced Size:996

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10916 2001-01-01 Release 2 assignment
CG10916 2001-10-10 Blastp of sequenced clone
CG10916 2003-01-01 Sim4 clustering to Release 3
CG10916 2008-04-29 Release 5.5 accounting
CG10916 2008-08-15 Release 5.9 accounting
CG10916 2008-12-18 5.12 accounting

Clone Sequence Records

LD46221.complete Sequence

996 bp (996 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061504

> LD46221.complete
TTGATACGAATCGTTTCGTTTTCCGCTCATTGTTGTGAAATAAATTTGGA
ACAGAAGAATAGAGCCACACATATTCAAAGCTCAGTATCCATAGGGACGT
AGTTATGGAGAGTAATAGTAGTGAAATGGAAGGTAACGGCGGAAAAATCG
CAGAAACTGCACCCACAAATGACTCATCACCTTCACTGAACATTTTATGT
GCAATTTGCAACGAGTTTTTCCGGGCCAACGACATAATTTTCTCAACTTC
ACGGTGCGGTCATGTATTCCACAAGGACTGCCTCACCCGATGGCTGAATA
GGTCCAGGACCTGCCCCCAATGCAGAGACCCATGCGACCGACGACGCGTG
CACCGATTGTACCTAAACTTCGCCGAGGCCCCGGAGTTCGATGACACCGA
ATTGCCCAAGGTGGCCATGGATTGGGTGCCCATTGATCTGGACAGAGACA
GCTTACCGGATGCCCACCTGCCGCCCGAGGGAGCTGTGCAGTGTGGCACC
AACGAAGACGGACTGCCCACGTATGTGGCCAGAGGATATTACCACGACGA
TCTCCTGCCTGCTCCTTATGTACCGGAAAAGAAGGCTGCCTTCGGTTCGC
ACAGCTGTAGCGCCCGAACTCTGACCGATGATGTCGAGATCCTGGTGCTC
AACGACTGTGACTACAAGTGGGTGCCCGGACAGCATGGAACATATCCGCG
GGATGCTCTGAACACGGGCTACTCCGAGCTGGGTGAGGTCACCTACACGG
GTCGTGGTCTTTACCAGGGTATCCTGCGTCTGGGCAAGGTGCATCCTTCC
CACAAGGTCATGTACATCCCGCATCATGGTCAAGAGGTGAGCGTAAACAC
CTACGAAGTCCTGGTGGTCACCCCACGTGACCAGGCAGATCGATGATGCT
GCTGATATCTTAAATCTCTTATGCCTTATTGTATGAATCTGTGTTATAAA
TACATATGTACGTCTTATTCTATTTTTGAAAAAAAAAAAAAAAAAA

LD46221.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG10916-RA 1020 CG10916-RA 36..1020 1..985 4925 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14060841..14061818 1..978 4830 99.6 Plus
chr2R 21145070 chr2R 14060410..14060487 436..513 300 92.3 Plus
chr2R 21145070 chr2R 14060488..14060583 771..866 285 86.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:31:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18173706..18174690 1..985 4925 100 Plus
2R 25286936 2R 18173275..18173352 436..513 300 92.3 Plus
2R 25286936 2R 18173353..18173448 771..866 285 86.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18174905..18175889 1..985 4925 100 Plus
2R 25260384 2R 18174474..18174551 436..513 300 92.3 Plus
2R 25260384 2R 18174552..18174647 771..866 285 86.4 Plus
Blast to na_te.dros performed on 2019-03-15 22:31:44 has no hits.

LD46221.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:32:21 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14060841..14061818 1..978 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:29:41 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
CG10916-RA 1..792 105..896 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:18 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
CG10916-RA 1..792 105..896 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:23:49 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
CG10916-RA 1..792 105..896 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:19 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
CG10916-RA 1..792 105..896 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:26:51 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
CG10916-RA 1..792 105..896 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:56 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
CG10916-RA 36..1013 1..978 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:18 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
CG10916-RA 36..1013 1..978 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:23:49 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
CG10916-RA 38..1015 1..978 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:19:19 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
CG10916-RA 36..1013 1..978 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:26:51 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
CG10916-RA 38..1015 1..978 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:32:21 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18173706..18174683 1..978 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:32:21 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18173706..18174683 1..978 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:32:21 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18173706..18174683 1..978 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:23:49 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14061211..14062188 1..978 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:56:03 Download gff for LD46221.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18174905..18175882 1..978 100   Plus

LD46221.pep Sequence

Translation from 104 to 895

> LD46221.pep
MESNSSEMEGNGGKIAETAPTNDSSPSLNILCAICNEFFRANDIIFSTSR
CGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEAPEFDDTEL
PKVAMDWVPIDLDRDSLPDAHLPPEGAVQCGTNEDGLPTYVARGYYHDDL
LPAPYVPEKKAAFGSHSCSARTLTDDVEILVLNDCDYKWVPGQHGTYPRD
ALNTGYSELGEVTYTGRGLYQGILRLGKVHPSHKVMYIPHHGQEVSVNTY
EVLVVTPRDQADR*

LD46221.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12141-PA 258 GF12141-PA 16..258 21..263 856 63 Plus
Dana\GF12140-PA 263 GF12140-PA 13..262 18..262 745 58.8 Plus
Dana\GF12778-PA 154 GF12778-PA 15..154 124..263 377 50.7 Plus
Dana\GF22376-PA 285 GF22376-PA 156..283 124..254 244 40.5 Plus
Dana\GF16764-PA 148 GF16764-PA 15..141 124..253 243 37.7 Plus
Dana\GF22376-PA 285 GF22376-PA 15..141 124..253 240 38.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21853-PA 263 GG21853-PA 1..262 1..262 1255 87 Plus
Dere\GG20622-PA 269 GG20622-PA 1..264 1..261 712 53.2 Plus
Dere\GG21852-PA 155 GG21852-PA 1..155 108..262 664 78.7 Plus
Dere\GG17790-PA 285 GG17790-PA 15..141 124..253 242 39.2 Plus
Dere\GG11468-PA 148 GG11468-PA 15..141 124..253 237 37.7 Plus
Dere\GG17790-PA 285 GG17790-PA 156..283 124..254 234 42 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20284-PA 246 GH20284-PA 7..246 19..263 767 59.2 Plus
Dgri\GH19468-PA 146 GH19468-PA 15..141 124..253 248 40 Plus
Dgri\GH21600-PA 287 GH21600-PA 8..142 116..254 232 42.4 Plus
Dgri\GH23671-PA 272 GH23671-PA 2..129 124..254 222 40.5 Plus
Dgri\GH23671-PA 272 GH23671-PA 145..270 126..254 219 39.5 Plus
Dgri\GH20307-PA 285 GH20307-PA 15..142 124..254 219 39.7 Plus
Dgri\GH20307-PA 285 GH20307-PA 158..283 126..254 219 39.5 Plus
Dgri\GH21600-PA 287 GH21600-PA 158..284 124..253 176 33.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG10916-PB 263 CG10916-PB 1..263 1..263 1446 100 Plus
CG10916-PA 263 CG10916-PA 1..263 1..263 1446 100 Plus
CG44250-PB 286 CG44250-PB 8..147 116..259 261 42.4 Plus
CG44250-PC 297 CG44250-PC 19..158 116..259 261 42.4 Plus
CG32633-PB 285 CG32633-PB 156..283 124..254 259 41.2 Plus
CG32633-PA 285 CG32633-PA 156..283 124..254 259 41.2 Plus
CG13321-PB 286 CG13321-PB 16..143 124..254 251 41 Plus
CG13321-PA 286 CG13321-PA 16..143 124..254 251 41 Plus
CG31086-PB 148 CG31086-PB 15..141 124..253 248 37.6 Plus
CG31086-PA 148 CG31086-PA 15..141 124..253 248 37.6 Plus
CG32633-PB 285 CG32633-PB 15..141 124..253 239 37.7 Plus
CG32633-PA 285 CG32633-PA 15..141 124..253 239 37.7 Plus
CG13321-PB 286 CG13321-PB 159..284 126..254 219 38.8 Plus
CG13321-PA 286 CG13321-PA 159..284 126..254 219 38.8 Plus
CG44250-PB 286 CG44250-PB 158..283 124..253 203 36.2 Plus
CG44250-PC 297 CG44250-PC 169..294 124..253 203 36.2 Plus
nopo-PB 434 CG5140-PB 2..63 28..90 195 52.4 Plus
nopo-PA 435 CG5140-PA 2..63 28..90 195 52.4 Plus
CG44251-PA 478 CG44251-PA 15..142 124..254 176 34.4 Plus
CG4325-PB 158 CG4325-PB 5..67 29..94 168 50 Plus
CG4325-PA 158 CG4325-PA 5..67 29..94 168 50 Plus
CG10527-PA 296 CG10527-PA 183..294 140..254 151 30.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19455-PA 246 GI19455-PA 7..246 19..263 753 57.6 Plus
Dmoj\GI19569-PA 286 GI19569-PA 8..147 116..259 251 42.4 Plus
Dmoj\GI19977-PA 285 GI19977-PA 14..142 122..254 230 42.1 Plus
Dmoj\GI19977-PA 285 GI19977-PA 158..283 126..254 218 39.5 Plus
Dmoj\GI24703-PA 159 GI24703-PA 15..139 124..251 215 36.7 Plus
Dmoj\GI19570-PA 480 GI19570-PA 337..465 124..254 200 35.1 Plus
Dmoj\GI19569-PA 286 GI19569-PA 149..283 107..253 188 33.3 Plus
Dmoj\GI19570-PA 480 GI19570-PA 17..144 124..254 154 30.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17754-PA 253 GL17754-PA 3..248 16..262 904 67.6 Plus
Dper\GL21834-PA 148 GL21834-PA 15..141 124..253 241 39.2 Plus
Dper\GL11485-PA 285 GL11485-PA 153..283 120..254 237 42.2 Plus
Dper\GL11485-PA 285 GL11485-PA 14..142 122..254 232 42.9 Plus
Dper\GL17755-PA 432 GL17755-PA 2..63 28..90 199 50.8 Plus
Dper\GL15128-PA 141 GL15128-PA 5..66 29..93 173 52.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10640-PA 253 GA10640-PA 3..248 16..262 950 70 Plus
Dpse\GA17750-PA 287 GA17750-PA 8..147 116..259 252 42.4 Plus
Dpse\GA15997-PA 148 GA15997-PA 15..141 124..253 243 40.8 Plus
Dpse\GA24742-PA 285 GA24742-PA 153..283 120..254 237 42.2 Plus
Dpse\GA24742-PA 285 GA24742-PA 14..142 122..254 232 42.9 Plus
Dpse\GA18686-PA 431 GA18686-PA 2..63 28..90 199 50.8 Plus
Dpse\GA17750-PA 287 GA17750-PA 151..284 116..253 186 34.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21853-PA 266 GM21853-PA 1..263 1..263 1340 93.5 Plus
Dsec\GM20320-PA 297 GM20320-PA 19..158 116..259 249 41.7 Plus
Dsec\GM21436-PA 286 GM21436-PA 15..143 122..254 237 41.2 Plus
Dsec\GM17616-PA 285 GM17616-PA 156..283 124..254 227 41.2 Plus
Dsec\GM17616-PA 285 GM17616-PA 15..141 124..253 211 36.2 Plus
Dsec\GM21854-PA 432 GM21854-PA 2..134 28..158 208 34.5 Plus
Dsec\GM20320-PA 297 GM20320-PA 169..294 124..253 203 36.9 Plus
Dsec\GM21436-PA 286 GM21436-PA 159..284 126..254 199 38.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11346-PA 263 GD11346-PA 1..263 1..263 1351 94.3 Plus
Dsim\GD25797-PA 642 GD25797-PA 8..142 116..254 249 42.4 Plus
Dsim\GD21274-PA 148 GD21274-PA 15..141 124..253 241 37.7 Plus
Dsim\GD24809-PA 285 GD24809-PA 15..141 124..253 237 38.5 Plus
Dsim\GD10934-PA 286 GD10934-PA 15..143 122..254 237 41.2 Plus
Dsim\GD24809-PA 285 GD24809-PA 156..283 124..254 227 41.2 Plus
Dsim\GD10934-PA 286 GD10934-PA 159..284 126..254 202 38.8 Plus
Dsim\GD25797-PA 642 GD25797-PA 285..412 124..254 164 34.4 Plus
Dsim\GD25797-PA 642 GD25797-PA 158..270 124..240 160 35.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21206-PA 249 GJ21206-PA 7..249 16..263 782 57.7 Plus
Dvir\GJ23921-PA 146 GJ23921-PA 15..141 124..253 236 38.5 Plus
Dvir\GJ19513-PA 285 GJ19513-PA 156..285 124..256 236 39.8 Plus
Dvir\GJ21230-PA 285 GJ21230-PA 14..142 122..254 236 42.1 Plus
Dvir\GJ19513-PA 285 GJ19513-PA 15..141 124..253 235 40 Plus
Dvir\GJ21230-PA 285 GJ21230-PA 158..283 126..254 214 38.8 Plus
Dvir\GJ19929-PA 434 GJ19929-PA 2..63 28..90 194 50.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22966-PA 266 GK22966-PA 24..266 19..263 796 61.2 Plus
Dwil\GK13296-PA 148 GK13296-PA 15..141 124..253 249 40.8 Plus
Dwil\GK20869-PA 143 GK20869-PA 14..141 124..254 241 40.5 Plus
Dwil\GK20087-PA 285 GK20087-PA 15..141 124..253 238 37.7 Plus
Dwil\GK22862-PA 143 GK22862-PA 14..143 124..256 237 39.8 Plus
Dwil\GK20087-PA 285 GK20087-PA 156..283 124..254 228 38.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11932-PA 263 GE11932-PA 1..263 1..263 1262 87.8 Plus
Dyak\GE11812-PA 269 GE11812-PA 1..265 1..259 702 53.5 Plus
Dyak\GE23659-PA 148 GE23659-PA 15..141 124..253 243 37.7 Plus
Dyak\GE12508-PA 286 GE12508-PA 15..143 122..254 239 41.9 Plus
Dyak\GE17086-PA 285 GE17086-PA 15..141 124..253 238 38.5 Plus
Dyak\GE17086-PA 285 GE17086-PA 156..283 124..254 230 41.2 Plus
Dyak\GE12508-PA 286 GE12508-PA 159..284 126..254 199 38 Plus

LD46221.hyp Sequence

Translation from 104 to 895

> LD46221.hyp
MESNSSEMEGNGGKIAETAPTNDSSPSLNILCAICNEFFRANDIIFSTSR
CGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEAPEFDDTEL
PKVAMDWVPIDLDRDSLPDAHLPPEGAVQCGTNEDGLPTYVARGYYHDDL
LPAPYVPEKKAAFGSHSCSARTLTDDVEILVLNDCDYKWVPGQHGTYPRD
ALNTGYSELGEVTYTGRGLYQGILRLGKVHPSHKVMYIPHHGQEVSVNTY
EVLVVTPRDQADR*

LD46221.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG10916-PB 263 CG10916-PB 1..263 1..263 1446 100 Plus
CG10916-PA 263 CG10916-PA 1..263 1..263 1446 100 Plus
CG44250-PB 286 CG44250-PB 8..147 116..259 261 42.4 Plus
CG44250-PC 297 CG44250-PC 19..158 116..259 261 42.4 Plus
CG32633-PB 285 CG32633-PB 156..283 124..254 259 41.2 Plus
CG44250-PB 286 CG44250-PB 158..283 124..253 203 36.2 Plus
CG44250-PC 297 CG44250-PC 169..294 124..253 203 36.2 Plus