Clone LD46333 Report

Search the DGRC for LD46333

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:463
Well:33
Vector:pOT2
Associated Gene/TranscriptCG9293-RA
Protein status:LD46333.pep: gold
Preliminary Size:1213
Sequenced Size:1031

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9293 2001-01-01 Release 2 assignment
CG9293 2001-10-10 Blastp of sequenced clone
CG9293 2003-01-01 Sim4 clustering to Release 3
CG9293 2008-04-29 Release 5.5 accounting
CG9293 2008-08-15 Release 5.9 accounting
CG9293 2008-12-18 5.12 accounting

Clone Sequence Records

LD46333.complete Sequence

1031 bp (1031 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061507

> LD46333.complete
TAAACAGACGCTGGAATTTAGCTTACACACTCCATATTCTTTGTTAAATC
CGATATTTGACACCGAAAATGTCATCGGCTATATACCTAGAGAACTATTT
AGACGGATTGGAAAGTCTGCCAACGGAGCTGGAGAGAAATTTTAAGCTGA
TGCGAAAATTAGACGATCGAGCACAAACAGCGATGAAGAGCATCGATAGC
CATGCCAAGGACTTTATGCGCAAGCTGGGCGAGAACGGGGCCATGAGCGA
GGATGAGAGGAGGGAGCGCCAGGAGGATATCAAGGCACTGTTCGGAAAGG
CCAAGGAGTACAGCGACGACAAGGTGCAGCTGGCCATTCAGACCTACGAA
CTAGTGGACAAGCAGATACGGCGACTGGACAACGATTTAGCACGCTTCGA
GGGTGAGATTCAGGAGAAGGCCTCATCCACGCGTGCCAAATCCGAGGAAG
TGGTGGCCAAGAAAGGTCGCAAAAAAACCAAGGACAGCAAGACGACGGGC
AAAAAGAAAAAGTCCGCATCCTCGGATGAGGAAACTGGGCGCGGCAACAA
CCAATCTAACGCCAATTCCAGTGTCAATTCGAGCAGCAATGCCGGGCAAG
GTAGCAAAAAGAAAAAGTCCAAGGTAAATCAAGAAAAAGAAACTCGCAAG
GGGGGCGCTCAAAAGAAAACCGTCGAGGTTGATGACTCTGAGAAGGAATC
GTGCCACACGGCCGCCACTCATCCCAGCGACGTTATGGACATGCCCGTCG
ATCCCAATGAGCCCACATATTGCCTATGCCACCAGGTGTCCTATGGAGAG
ATGATTGGCTGCGACAATCCCGACTGTCCCATCGAGTGGTTTCACTTCGC
TTGTGTTGGCCTCACCACAAAGCCAAAGGGCAAGTGGTTCTGTCCCAAGT
GTACGCAGGACAGAAAGAAGAAATAGATGCAATCCTTTATGATTACTTAG
AATACTACTTTAGATTAAGCACAAAATTACCTATTTAAATAAAGCCACGG
CTACTATAACTTCAAAAAAAAAAAAAAAAAA

LD46333.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG9293-RA 1112 CG9293-RA 95..1108 1..1014 5070 100 Plus
CG9293.a 1030 CG9293.a 20..1030 1..1014 5000 99.7 Plus
CG9293-RB 1070 CG9293-RB 95..717 1..623 3115 100 Plus
CG9293-RB 1070 CG9293-RB 715..1066 663..1014 1760 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13385429..13385786 462..105 1790 100 Minus
chr2L 23010047 chr2L 13385160..13385362 665..463 1015 100 Minus
chr2L 23010047 chr2L 13384520..13384708 1013..825 945 100 Minus
chr2L 23010047 chr2L 13384771..13384931 824..664 805 100 Minus
chr2L 23010047 chr2L 13385848..13385953 106..1 530 100 Minus
chrX 22417052 chrX 18540034..18540186 901..749 210 75.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:25:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13386757..13387114 462..105 1790 100 Minus
2L 23513712 2L 13386488..13386690 665..463 1015 100 Minus
2L 23513712 2L 13385847..13386036 1014..825 950 100 Minus
2L 23513712 2L 13386099..13386259 824..664 805 100 Minus
2L 23513712 2L 13387176..13387281 106..1 530 100 Minus
X 23542271 X 18650867..18651019 901..749 210 75.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13386757..13387114 462..105 1790 100 Minus
2L 23513712 2L 13386488..13386690 665..463 1015 100 Minus
2L 23513712 2L 13385847..13386036 1014..825 950 100 Minus
2L 23513712 2L 13386099..13386259 824..664 805 100 Minus
2L 23513712 2L 13387176..13387281 106..1 530 100 Minus
X 23527363 X 18658965..18659089 901..777 205 77.6 Minus
Blast to na_te.dros performed on 2019-03-16 11:25:17 has no hits.

LD46333.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:26:25 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13384520..13384708 825..1013 100 <- Minus
chr2L 13384771..13384929 666..824 100 <- Minus
chr2L 13385160..13385362 463..665 100 <- Minus
chr2L 13385429..13385785 106..462 100 <- Minus
chr2L 13385849..13385953 1..105 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:29:55 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RA 1..858 69..926 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:19 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RA 1..858 69..926 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:47:10 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RA 1..858 69..926 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:20 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RA 1..858 69..926 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:29 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RA 1..858 69..926 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:58 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RA 19..1031 1..1013 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:19 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RA 19..1031 1..1013 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:47:10 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RA 32..1044 1..1013 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:19:20 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RA 19..1031 1..1013 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:29 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RA 32..1044 1..1013 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:25 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13386757..13387113 106..462 100 <- Minus
2L 13385848..13386036 825..1013 100 <- Minus
2L 13386099..13386257 666..824 100 <- Minus
2L 13386488..13386690 463..665 100 <- Minus
2L 13387177..13387281 1..105 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:25 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13386757..13387113 106..462 100 <- Minus
2L 13385848..13386036 825..1013 100 <- Minus
2L 13386099..13386257 666..824 100 <- Minus
2L 13386488..13386690 463..665 100 <- Minus
2L 13387177..13387281 1..105 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:25 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13386757..13387113 106..462 100 <- Minus
2L 13385848..13386036 825..1013 100 <- Minus
2L 13386099..13386257 666..824 100 <- Minus
2L 13386488..13386690 463..665 100 <- Minus
2L 13387177..13387281 1..105 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:47:10 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13385848..13386036 825..1013 100 <- Minus
arm_2L 13386099..13386257 666..824 100 <- Minus
arm_2L 13386488..13386690 463..665 100 <- Minus
arm_2L 13386757..13387113 106..462 100 <- Minus
arm_2L 13387177..13387281 1..105 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:56:05 Download gff for LD46333.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13386488..13386690 463..665 100 <- Minus
2L 13386757..13387113 106..462 100 <- Minus
2L 13387177..13387281 1..105 100   Minus
2L 13385848..13386036 825..1013 100 <- Minus
2L 13386099..13386257 666..824 100 <- Minus

LD46333.pep Sequence

Translation from 68 to 925

> LD46333.pep
MSSAIYLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFM
RKLGENGAMSEDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQI
RRLDNDLARFEGEIQEKASSTRAKSEEVVAKKGRKKTKDSKTTGKKKKSA
SSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVNQEKETRKGGAQKK
TVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDN
PDCPIEWFHFACVGLTTKPKGKWFCPKCTQDRKKK*

LD46333.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21663-PA 271 GF21663-PA 1..271 1..285 1220 86.7 Plus
Dana\GF18170-PA 441 GF18170-PA 361..416 227..282 277 69.6 Plus
Dana\GF22402-PA 723 GF22402-PA 661..718 228..285 272 63.8 Plus
Dana\GF22402-PA 723 GF22402-PA 2..160 5..170 183 31.3 Plus
Dana\GF11347-PA 2234 GF11347-PA 2179..2223 234..278 174 55.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10204-PA 271 GG10204-PA 1..271 1..285 1419 94 Plus
Dere\GG16752-PA 437 GG16752-PA 357..412 227..282 276 69.6 Plus
Dere\GG18104-PA 676 GG18104-PA 614..671 228..285 271 63.8 Plus
Dere\GG18104-PA 676 GG18104-PA 2..176 5..186 199 30.8 Plus
Dere\GG21797-PA 2160 GG21797-PA 2101..2145 234..278 171 55.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13451-PA 275 GH13451-PA 1..275 1..285 1246 85.5 Plus
Dgri\GH12807-PA 130 GH12807-PA 68..125 228..285 253 63.8 Plus
Dgri\GH15818-PA 448 GH15818-PA 374..423 233..282 245 68 Plus
Dgri\GH20921-PA 2595 GH20921-PA 2535..2579 234..278 175 55.6 Plus
Dgri\GH12806-PA 570 GH12806-PA 2..161 5..176 172 30.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Ing5-PA 285 CG9293-PA 1..285 1..285 1493 100 Plus
Ing5-PB 271 CG9293-PB 1..271 1..285 1397 95.1 Plus
CG7379-PA 433 CG7379-PA 223..408 112..282 294 36.3 Plus
Ing3-PA 686 CG6632-PA 624..681 228..285 256 63.8 Plus
Ing3-PA 686 CG6632-PA 2..176 5..186 199 30.2 Plus
MESR4-PD 2151 CG4903-PD 2092..2136 234..278 163 55.6 Plus
MESR4-PC 2169 CG4903-PC 2110..2154 234..278 163 55.6 Plus
MESR4-PB 2171 CG4903-PB 2112..2156 234..278 163 55.6 Plus
MESR4-PA 2171 CG4903-PA 2112..2156 234..278 163 55.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14043-PA 288 GI14043-PA 1..288 1..285 1350 91.7 Plus
Dmoj\GI15078-PA 679 GI15078-PA 617..674 228..285 270 63.8 Plus
Dmoj\GI17821-PA 417 GI17821-PA 343..392 233..282 244 70 Plus
Dmoj\GI15078-PA 679 GI15078-PA 2..170 5..173 185 28.2 Plus
Dmoj\GI18359-PA 2388 GI18359-PA 2329..2373 234..278 173 55.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25709-PA 193 GL25709-PA 1..181 1..179 822 90.1 Plus
Dper\GL27018-PA 728 GL27018-PA 666..723 228..285 277 65.5 Plus
Dper\GL27018-PA 728 GL27018-PA 2..111 5..115 178 36 Plus
Dper\GL11465-PA 2492 GL11465-PA 2433..2477 234..278 171 53.3 Plus
Dper\GL20470-PA 63 GL20470-PA 1..38 245..282 168 71.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21675-PA 273 GA21675-PA 1..273 1..285 1286 87.1 Plus
Dpse\GA22529-PA 273 GA22529-PA 1..273 1..285 1281 86.8 Plus
Dpse\GA22347-PA 737 GA22347-PA 675..732 228..285 276 65.5 Plus
Dpse\GA20308-PA 445 GA20308-PA 365..420 227..282 273 69.6 Plus
Dpse\GA22347-PA 737 GA22347-PA 2..111 5..115 178 36 Plus
Dpse\GA18514-PA 2497 GA18514-PA 2438..2482 234..278 171 53.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25576-PA 271 GM25576-PA 1..271 1..285 1419 94.4 Plus
Dsec\GM15338-PA 433 GM15338-PA 353..408 227..282 277 69.6 Plus
Dsec\GM22794-PA 688 GM22794-PA 626..683 228..285 272 63.8 Plus
Dsec\GM22794-PA 688 GM22794-PA 2..176 5..186 196 30.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22064-PA 253 GD22064-PA 1..253 1..285 1278 88.1 Plus
Dsim\GD24472-PA 288 GD24472-PA 2..283 5..285 448 33.9 Plus
Dsim\GD20212-PA 433 GD20212-PA 353..408 227..282 277 69.6 Plus
Dsim\GD11289-PA 2160 GD11289-PA 2101..2145 234..278 172 55.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18259-PA 288 GJ18259-PA 1..288 1..285 1391 91.3 Plus
Dvir\GJ18885-PA 663 GJ18885-PA 601..658 228..285 270 63.8 Plus
Dvir\GJ17317-PA 419 GJ17317-PA 345..394 233..282 244 70 Plus
Dvir\GJ18885-PA 663 GJ18885-PA 2..111 5..115 181 34.2 Plus
Dvir\GJ21428-PA 2481 GJ21428-PA 2422..2466 234..278 175 55.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15283-PA 279 GK15283-PA 1..279 1..285 1172 85.1 Plus
Dwil\GK10188-PA 774 GK10188-PA 712..769 228..285 269 63.8 Plus
Dwil\GK22501-PA 433 GK22501-PA 359..408 233..282 248 70 Plus
Dwil\GK10188-PA 774 GK10188-PA 2..111 5..115 178 34.2 Plus
Dwil\GK21900-PA 2122 GK21900-PA 2063..2107 234..278 172 55.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11644-PA 271 GE11644-PA 1..271 1..285 1415 94 Plus
Dyak\GE25248-PA 438 GE25248-PA 358..413 227..282 279 69.6 Plus
Dyak\GE15505-PA 679 GE15505-PA 617..674 228..285 266 62.1 Plus
Dyak\GE15505-PA 679 GE15505-PA 2..176 5..186 185 29.7 Plus
Dyak\GE11872-PA 2159 GE11872-PA 2100..2144 234..278 172 55.6 Plus

LD46333.hyp Sequence

Translation from 68 to 925

> LD46333.hyp
MSSAIYLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFM
RKLGENGAMSEDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQI
RRLDNDLARFEGEIQEKASSTRAKSEEVVAKKGRKKTKDSKTTGKKKKSA
SSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVNQEKETRKGGAQKK
TVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDN
PDCPIEWFHFACVGLTTKPKGKWFCPKCTQDRKKK*

LD46333.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG9293-PA 285 CG9293-PA 1..285 1..285 1493 100 Plus
CG9293-PB 271 CG9293-PB 1..271 1..285 1397 95.1 Plus
CG7379-PA 433 CG7379-PA 223..408 112..282 294 36.3 Plus
Ing3-PA 686 CG6632-PA 624..681 228..285 256 63.8 Plus
Ing3-PA 686 CG6632-PA 2..176 5..186 199 30.2 Plus
MESR4-PD 2151 CG4903-PD 2092..2136 234..278 163 55.6 Plus