Clone LD46344 Report

Search the DGRC for LD46344

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:463
Well:44
Vector:pOT2
Associated Gene/TranscriptPhb2-RA
Protein status:LD46344.pep: gold
Preliminary Size:1631
Sequenced Size:1486

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15081 2001-01-01 Release 2 assignment
CG15081 2001-10-10 Blastp of sequenced clone
CG15081 2003-01-01 Sim4 clustering to Release 3
l(2)03709 2008-04-29 Release 5.5 accounting
l(2)03709 2008-08-15 Release 5.9 accounting
l(2)03709 2008-12-18 5.12 accounting

Clone Sequence Records

LD46344.complete Sequence

1486 bp (1486 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061508

> LD46344.complete
CACCGAACCAAACGTGCGTGAGAGTTTCCCAATTTTAAGACAAACAAGAT
GGCACAGAGCAAATTGAACGATCTTGCCGGCAAGCTGGGCAAAGGTGGTC
CGCCGGGATTGGGAATCGGACTGAAGGTCCTGGCCGCCGTGGGAGCAGCC
GCCTATGGAGTCAGTCAGTCCCTGTACACCGTTGAGGGTGGTCACCGCGC
CATCATCTTCAGCCGTCTGGGCGGCATCCAGAGCGACATTTACTCCGAGG
GACTGCACGTGCGCATCCCCTGGTTCCAGTATCCCATTATCTATGACATT
CGCTCGCGTCCCCGCAAAATATCCTCGCCCACTGGCTCCAAGGATCTGCA
GATGATCAACATCTCGCTGCGTGTGCTGTCGCGCCCCGATTCCCTGAACC
TGCCCTATCTGCACAAGCAGCTGGGCGTGGACTACGACGAGAAGGTGCTG
CCCTCCATTTGCAACGAGGTGCTGAAGAGCGTGATTGCCAAGTTCAATGC
CTCGCAGCTTATTACCCAGCGTCAGCAGGTATCCCTACTCATCCGCAAGG
AGCTGGTCGAGCGCGCCCGCGACTTCAACATCATTCTGGACGATGTGTCC
CTCACCGAGCTGAGCTTCGGCAAGGAATACACGGCGGCCATTGAGGCCAA
ACAAGTGGCTCAGCAGGAGGCACAGCGGGCTGTCTTCTTTGTGGAGCGCG
CCAAGCAGGAGAAGCAGCAGAAGATTGTTCAGGCTGAGGGAGAAGCCGAG
GCTGCTAAAATGTTAGGTCTGGCCGTGAAGCAGAACCCAGCCTACCTGAA
GCTGCGCAAGCTGCGTGCCGCTCAAAGCATTGCACGCACGATTGCCAGCT
CACAGAACAAGGTCTATTTGTCGGCGGATAGCTTGATGCTTAACATCCAG
GACTCTGGCTTCGATGACATGACCGAGAAGGTTTACAAAAGTAAATAGCT
CTCGTTTTGATTAACAAAAAGAGTTTACTTTTAAGTTGAAAACACTTGTA
CTTTTGGTTTCAATCACATTGGCCAAAACTTAGACATAGCCTTCATAATT
GAGTAATTTCTAACGCGTTTTCCGTACTCCATCTCTCTTCCTATTTGCCG
CACAAAATTTCGTTCTGTTAACGTTTCACCCGATCGCGCAACCCAGTAGC
CGATGACCTGGACTAGGAGGCGATCCACATTCGTTGTTAATTAATTTTTA
TTGAAATTCCTTCGAGCTAGAGCCTAAGTACCGTTTAGTTTTAACCACTC
CCAAGCGGCGCATTGGCTTCATTTTTTCACGAATTATCTGCCAAGGATTG
AAACACGGCCAGGCATTTTGTGGACCAATGATACCAATGCGGGCAAATGG
CCGCATCAGCATTTAACTTTCCATGTCCCATCATCGAGAGTCACGTGAAA
CGGAAACTGAAAATAAATGCGTACTGAGAACTGTCTGAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD46344.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)03709.d 1559 l(2)03709.d 34..1328 1..1295 6475 100 Plus
l(2)03709.b 1526 l(2)03709.b 34..1325 1..1295 6405 99.7 Plus
l(2)03709-RF 1633 l(2)03709-RF 144..1402 37..1295 6295 100 Plus
l(2)03709.d 1559 l(2)03709.d 1381..1531 1289..1439 755 100 Plus
l(2)03709-RF 1633 l(2)03709-RF 1455..1605 1289..1439 755 100 Plus
l(2)03709.b 1526 l(2)03709.b 1378..1526 1289..1437 745 100 Plus
l(2)03709-RF 1633 l(2)03709-RF 12..47 1..36 180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14708277..14708732 840..1295 2265 99.8 Plus
chr2R 21145070 chr2R 14707288..14707638 181..531 1710 99.1 Plus
chr2R 21145070 chr2R 14707696..14707931 527..762 1180 100 Plus
chr2R 21145070 chr2R 14708785..14708933 1289..1437 745 100 Plus
chr2R 21145070 chr2R 14706723..14706867 37..181 725 100 Plus
chr2R 21145070 chr2R 14708135..14708212 763..840 375 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18821183..18821638 840..1295 2280 100 Plus
2R 25286936 2R 18820195..18820545 181..531 1755 100 Plus
2R 25286936 2R 18820603..18820838 527..762 1180 100 Plus
2R 25286936 2R 18821691..18821841 1289..1439 755 100 Plus
2R 25286936 2R 18819621..18819765 37..181 725 100 Plus
2R 25286936 2R 18821041..18821118 763..840 390 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18822382..18822837 840..1295 2280 100 Plus
2R 25260384 2R 18821394..18821744 181..531 1755 100 Plus
2R 25260384 2R 18821802..18822037 527..762 1180 100 Plus
2R 25260384 2R 18822890..18823040 1289..1439 755 100 Plus
2R 25260384 2R 18820820..18820964 37..181 725 100 Plus
2R 25260384 2R 18822240..18822317 763..840 390 100 Plus
2R 25260384 2R 18820688..18820723 1..36 180 100 Plus
Blast to na_te.dros performed 2019-03-16 20:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 2527..2594 927..993 130 67.6 Plus

LD46344.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:44:08 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14706723..14706867 37..181 100 -> Plus
chr2R 14707289..14707635 182..528 99 -> Plus
chr2R 14707698..14707936 529..766 98 -> Plus
chr2R 14706591..14706626 1..36 100 -> Plus
chr2R 14708139..14708212 767..840 98 -> Plus
chr2R 14708278..14708731 841..1295 99 -> Plus
chr2R 14708792..14708933 1296..1437 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:29:59 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)03709-RA 1..900 49..948 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:38:59 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)03709-RA 1..900 49..948 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:24 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)03709-RB 1..900 49..948 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:07:48 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)03709-RB 1..900 49..948 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:52:28 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
Phb2-RB 1..900 49..948 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:20:11 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)03709-RB 23..1458 1..1437 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:38:59 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)03709-RA 1..29 8..36 100 -> Plus
l(2)03709-RA 126..1525 37..1437 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:24 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)03709-RA 23..58 1..36 100 -> Plus
l(2)03709-RA 155..1554 37..1437 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:07:48 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)03709-RB 23..1458 1..1437 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:52:28 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
Phb2-RA 23..58 1..36 100 -> Plus
Phb2-RA 155..1554 37..1437 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:44:08 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18819489..18819524 1..36 100 -> Plus
2R 18819621..18819765 37..181 100 -> Plus
2R 18820196..18820542 182..528 100 -> Plus
2R 18820605..18820843 529..766 98 -> Plus
2R 18821045..18821118 767..840 100 -> Plus
2R 18821184..18821637 841..1295 99 -> Plus
2R 18821698..18821839 1296..1437 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:44:08 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18819489..18819524 1..36 100 -> Plus
2R 18819621..18819765 37..181 100 -> Plus
2R 18820196..18820542 182..528 100 -> Plus
2R 18820605..18820843 529..766 98 -> Plus
2R 18821045..18821118 767..840 100 -> Plus
2R 18821184..18821637 841..1295 99 -> Plus
2R 18821698..18821839 1296..1437 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:44:08 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18819489..18819524 1..36 100 -> Plus
2R 18819621..18819765 37..181 100 -> Plus
2R 18820196..18820542 182..528 100 -> Plus
2R 18820605..18820843 529..766 98 -> Plus
2R 18821045..18821118 767..840 100 -> Plus
2R 18821184..18821637 841..1295 99 -> Plus
2R 18821698..18821839 1296..1437 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:24 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14706994..14707029 1..36 100 -> Plus
arm_2R 14707126..14707270 37..181 100 -> Plus
arm_2R 14707701..14708047 182..528 100 -> Plus
arm_2R 14708110..14708348 529..766 98 -> Plus
arm_2R 14708550..14708623 767..840 100 -> Plus
arm_2R 14708689..14709142 841..1295 99 -> Plus
arm_2R 14709203..14709344 1296..1437 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:44:00 Download gff for LD46344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18821395..18821741 182..528 100 -> Plus
2R 18821804..18822042 529..766 98 -> Plus
2R 18822244..18822317 767..840 100 -> Plus
2R 18822383..18822836 841..1295 99 -> Plus
2R 18822897..18823038 1296..1437 100   Plus
2R 18820688..18820723 1..36 100 -> Plus
2R 18820820..18820964 37..181 100 -> Plus

LD46344.pep Sequence

Translation from 48 to 947

> LD46344.pep
MAQSKLNDLAGKLGKGGPPGLGIGLKVLAAVGAAAYGVSQSLYTVEGGHR
AIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDL
QMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFN
ASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEA
KQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMLGLAVKQNPAYL
KLRKLRAAQSIARTIASSQNKVYLSADSLMLNIQDSGFDDMTEKVYKSK*

LD46344.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11118-PA 241 GF11118-PA 1..241 1..241 1237 97.5 Plus
Dana\GF15209-PA 276 GF15209-PA 12..270 21..283 640 50 Plus
Dana\GF11119-PA 105 GF11119-PA 10..68 239..297 301 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21927-PA 326 GG21927-PA 1..285 1..297 1467 95.6 Plus
Dere\GG21649-PA 276 GG21649-PA 12..270 21..283 672 50.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:42:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22126-PA 323 GH22126-PA 1..288 1..297 1461 95.3 Plus
Dgri\GH13482-PA 276 GH13482-PA 12..270 21..283 666 49.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Phb2-PF 299 CG15081-PF 1..299 1..299 1476 100 Plus
Phb2-PA 299 CG15081-PA 1..299 1..299 1476 100 Plus
Phb2-PB 299 CG15081-PB 1..299 1..299 1476 100 Plus
Phb2-PC 299 CG15081-PC 1..299 1..299 1476 100 Plus
Phb2-PE 338 CG15081-PE 1..297 1..297 1467 100 Plus
Phb2-PD 303 CG15081-PD 1..297 1..297 1467 100 Plus
l(2)37Cc-PD 276 CG10691-PD 12..270 21..283 644 50.6 Plus
l(2)37Cc-PA 276 CG10691-PA 12..270 21..283 644 50.6 Plus
l(2)37Cc-PB 276 CG10691-PB 12..270 21..283 644 50.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:42:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19355-PA 315 GI19355-PA 1..278 1..297 1411 92.3 Plus
Dmoj\GI17234-PA 276 GI17234-PA 12..270 21..283 631 49.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11231-PA 229 GL11231-PA 1..229 1..229 993 94.8 Plus
Dper\GL21128-PA 276 GL21128-PA 12..270 21..283 623 48.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13475-PA 331 GA13475-PA 1..288 1..297 1276 92.9 Plus
Dpse\GA10498-PA 276 GA10498-PA 12..270 21..283 623 48.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21919-PA 361 GM21919-PA 1..320 1..297 1513 92.2 Plus
Dsec\GM17028-PA 276 GM17028-PA 12..270 21..283 672 50.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15441-PA 361 GD15441-PA 1..320 1..297 1513 92.2 Plus
Dsim\GD21777-PA 276 GD21777-PA 12..270 21..283 672 50.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20339-PA 323 GJ20339-PA 1..288 1..297 1469 95.6 Plus
Dvir\GJ17994-PA 276 GJ17994-PA 12..270 21..283 660 49.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18842-PA 299 GK18842-PA 1..299 1..299 1530 98 Plus
Dwil\GK20926-PA 326 GK20926-PA 1..288 1..297 1474 95.6 Plus
Dwil\GK24235-PA 276 GK24235-PA 12..270 21..283 636 49.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12002-PA 338 GE12002-PA 1..297 1..297 1553 100 Plus
Dyak\GE12669-PA 276 GE12669-PA 12..270 21..283 672 50.6 Plus

LD46344.hyp Sequence

Translation from 48 to 880

> LD46344.hyp
MAQSKLNDLAGKLGKGGPPGLGIGLKVLAAVGAAAYGVSQSLYTVEGGHR
AIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDL
QMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFN
ASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEA
KQVAQQEAQRAVFFVERAKQEKQQKIVQAEGEAEAAKMISSGREAEPSLP
EAAQAACRSKHCTHDCQLTEQGLFVGG*

LD46344.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
Phb2-PF 299 CG15081-PF 1..248 1..248 1186 96.4 Plus
Phb2-PA 299 CG15081-PA 1..248 1..248 1186 96.4 Plus
Phb2-PB 299 CG15081-PB 1..248 1..248 1186 96.4 Plus
Phb2-PC 299 CG15081-PC 1..248 1..248 1186 96.4 Plus
Phb2-PD 303 CG15081-PD 1..248 1..248 1186 96.4 Plus