Clone LD46359 Report

Search the DGRC for LD46359

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:463
Well:59
Vector:pOT2
Associated Gene/Transcriptx16-RA
Protein status:LD46359.pep: gold
Preliminary Size:1754
Sequenced Size:1689

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10203 2001-01-01 Release 2 assignment
CG10206 2001-01-01 Release 2 assignment
CG10203 2002-04-04 Blastp of sequenced clone
CG10203 2003-01-01 Sim4 clustering to Release 3
xl6 2008-04-29 Release 5.5 accounting
xl6 2008-08-15 Release 5.9 accounting
xl6 2008-12-18 5.12 accounting

Clone Sequence Records

LD46359.complete Sequence

1689 bp (1689 high quality bases) assembled on 2002-04-04

GenBank Submission: AY095057

> LD46359.complete
TCACTCTGTTTGCTACCCGGTAAAATGAGTTTTGCGCTGCATTAAATAGA
AAATAAACACAAAAATTCGCATCTGCCGACCGTGTTAAGTGACTAAAAGT
GTTCGCCAGTGCGCGATTGACCGACCAAAGTGCCCAGGAAGGCGGTGGCA
AGTGATTCCAACCCATCATCGATTTTTTTCTGCGCTGCTGCCACATTAAT
TTGGGCCCGGGGAAAAGCGAAATAAACAGAAATGTCGCGCCATCCGAGCG
ATAGAAAGGTGTACGTGGGCGATCTGGGCAACAATGCCCGGAAGAACGAC
CTGGAGTATGTATTTGGAGCGTACGGCAGTTTGCGCAGCGTCTGGATAGC
CCGCAATCCGCCGGGCTTCGCCTTCGTGGAGTTTGAGAGTGCCCGCGATG
CGGCGGATGCGGTGCGCGGATTGGACGGACGGACGGTTTGCGGGCGCCGA
GCCCGTGTGGAATTGTCCACCGGAAAGTATGCTAGGTCCGGCGGTGGTGG
TGGCGGAGGTGGTGGAGGCGGTGGTGGTGGAGGACTCGGAGGACGCGACC
GAGGCGGCGGTGGTCGTGGGGACGATAAGTGCTACGAGTGCGGCGGACGG
GGGCATTTCGCTCGCCACTGTCGCGAAAGGAAGGCCAGGCAGCGACGCAG
AAGCAACTCATTCAGCAGATCTCGGAGCACATCGCGACGCAGGCGCACTC
GCTCCAAGTCCGGAACTCGATCCCGCAGTCGCTCCGCCGGCTCGGTGGGC
CGTCGCTCCGGCCGCTCGAACGGACGGGACGAGAACGGATCGGCGTCGAG
GTACAGCGACCACGAGCGCAACGGCAGTGGAGCGGTAGATTCACCGCCGC
CGCCAAAACGGCGCTATGAGGATGAGGACGATGACCGGGTTAGGGGATCG
CCGCGGTCGCGTTCCCGATCTCGATCGGCGTCGCCAGCGGTGCGCCGTGG
ATCGCCGCCCAGGCGTCGTGGTGACTCGTCCGCCTCACGATCCGTTTCAA
GGGACTAGCGACAGCGAACGGATGCAGACGGAGCCCGACATGCGATGATG
AGGGCCGGAGCTGCAACCCCCCGATGAATCCGGCGAGATGGGCTCTCCAC
GCACTGGACTCTAATCCTCATTCCCAAAAGAAACAACCTCACGTGTAACA
AGACAGATTCCCAAATACTTTTTCATGCAGTATCCATCTAAGGTTTTTAG
TTGTCCAAAACCATATTAGTTAAGGGTTTTAATTTATAGTGGAACTCGAG
TTTGCATATTTAGGTATTCTAATGTTCCAACACAACAACAAATACAAGCA
CACGCAGAACAAAGGAGAGCGCTTCGGAAAATCATTTGACGGAAGGAAAT
TTAAGATATAGAAATGTATCGGCAGCCGCAGATTAACGATCTAGTCAGGA
TTGCTATGTAAATTGATTTGCCTTGGATTTTATTTTGCTTACCCTGGAAT
TATACTCGAATGTGCAGAGGACGAAGCATCGCCACCATTTTCATGTCAAT
TTTACACAATTTTCAATTTATGCAACACAACAACTTGATTATTTGACTCC
AATCTCTGTATGATGTGTTTCTATATTCGTAATAATTAAGTATTGCAACA
GTGCATAATAATTATTCATACATTGATGTCATAGTTAAGTATTAAAAAAA
TACATATGTATGGATTCTTGAAAAAAAAAAAAAAAAAAA

LD46359.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
xl6-RA 2148 xl6-RA 361..2031 1..1671 8355 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6913479..6914501 1670..648 5085 99.8 Minus
chr2L 23010047 chr2L 6918622..6919271 650..1 3175 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6914380..6915403 1671..648 5120 100 Minus
2L 23513712 2L 6919524..6920173 650..1 3250 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6914380..6915403 1671..648 5120 100 Minus
2L 23513712 2L 6919524..6920173 650..1 3250 100 Minus
Blast to na_te.dros performed 2019-03-16 18:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
transib3 2883 transib3 TRANSIB3 2883bp 2790..2849 1488..1548 122 68.9 Plus

LD46359.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:08:11 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6913479..6914498 651..1670 99 <- Minus
chr2L 6918622..6919271 1..650 93   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:30:01 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
xl6-RA 1..777 232..1008 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:16:11 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
xl6-RA 1..777 232..1008 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:56 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
x16-RA 1..777 232..1008 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:57:29 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
xl6-RA 1..777 232..1008 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:31:19 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
x16-RA 1..777 232..1008 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:46:44 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
xl6-RA 102..1771 1..1670 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:16:11 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
xl6-RA 102..1771 1..1670 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:56 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
x16-RA 38..1707 1..1670 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:57:29 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
xl6-RA 102..1771 1..1670 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:31:19 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
x16-RA 38..1707 1..1670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:08:11 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6914381..6915400 651..1670 100 <- Minus
2L 6919524..6920173 1..650 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:08:11 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6914381..6915400 651..1670 100 <- Minus
2L 6919524..6920173 1..650 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:08:11 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6914381..6915400 651..1670 100 <- Minus
2L 6919524..6920173 1..650 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:56 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6914381..6915400 651..1670 100 <- Minus
arm_2L 6919524..6920173 1..650 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:30:00 Download gff for LD46359.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6914381..6915400 651..1670 100 <- Minus
2L 6919524..6920173 1..650 100   Minus

LD46359.pep Sequence

Translation from 231 to 1007

> LD46359.pep
MSRHPSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVE
FESARDAADAVRGLDGRTVCGRRARVELSTGKYARSGGGGGGGGGGGGGG
GLGGRDRGGGGRGDDKCYECGGRGHFARHCRERKARQRRRSNSFSRSRST
SRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNGSG
AVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVRRGSPPRRRGDSS
ASRSVSRD*

LD46359.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17902-PA 163 GF17902-PA 12..81 9..78 245 64.3 Plus
Dana\GF19500-PA 179 GF19500-PA 12..96 9..93 238 63.5 Plus
Dana\GF14472-PA 120 GF14472-PA 22..75 159..212 233 90.7 Plus
Dana\GF16525-PA 253 GF16525-PA 8..81 9..81 143 45.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23573-PA 121 GG23573-PA 4..121 141..258 516 99.2 Plus
Dere\GG17683-PA 144 GG17683-PA 12..81 9..78 241 64.3 Plus
Dere\GG19507-PA 159 GG19507-PA 12..96 9..93 229 63.5 Plus
Dere\GG23961-PA 200 GG23961-PA 11..81 9..79 205 54.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24472-PA 163 GH24472-PA 12..96 9..93 229 63.5 Plus
Dgri\GH13164-PA 347 GH13164-PA 255..347 161..258 215 68 Plus
Dgri\GH13017-PA 201 GH13017-PA 8..78 9..79 206 54.9 Plus
Dgri\GH18077-PA 252 GH18077-PA 8..81 9..81 144 45.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
x16-PA 258 CG10203-PA 1..258 1..258 1361 100 Plus
x16-PB 257 CG10203-PB 1..257 1..258 1344 99.6 Plus
Rbp1-like-PC 158 CG1987-PC 12..157 9..163 403 55.5 Plus
Rbp1-like-PA 158 CG1987-PA 12..157 9..163 403 55.5 Plus
Rbp1-like-PB 247 CG1987-PB 12..176 9..164 373 47.3 Plus
Rbp1-PA 135 CG17136-PA 12..134 9..163 296 46.5 Plus
Rbp1-PD 144 CG17136-PD 12..103 9..100 280 57.6 Plus
Rsf1-PB 200 CG5655-PB 11..188 9..182 266 40.2 Plus
Rsf1-PA 200 CG5655-PA 11..188 9..182 266 40.2 Plus
B52-PN 350 CG10851-PN 156..326 49..257 196 34.9 Plus
B52-PC 350 CG10851-PC 156..326 49..257 196 34.9 Plus
B52-PA 350 CG10851-PA 156..326 49..257 196 34.9 Plus
B52-PO 355 CG10851-PO 161..331 49..257 196 34.9 Plus
B52-PM 355 CG10851-PM 161..331 49..257 196 34.9 Plus
SF2-PB 255 CG6987-PB 8..253 9..256 195 31.5 Plus
SF2-PA 255 CG6987-PA 8..253 9..256 195 31.5 Plus
B52-PO 355 CG10851-PO 5..299 9..257 195 29.9 Plus
B52-PM 355 CG10851-PM 5..299 9..257 195 29.9 Plus
B52-PB 329 CG10851-PB 5..299 9..257 195 29.9 Plus
B52-PN 350 CG10851-PN 5..294 9..257 194 30 Plus
B52-PC 350 CG10851-PC 5..294 9..257 194 30 Plus
B52-PA 350 CG10851-PA 5..294 9..257 194 30 Plus
CG9915-PC 820 CG9915-PC 249..440 72..256 182 35.7 Plus
CG9915-PB 820 CG9915-PB 249..440 72..256 182 35.7 Plus
snRNP-U1-70K-PC 448 CG8749-PC 102..346 8..245 179 26.9 Plus
snRNP-U1-70K-PA 448 CG8749-PA 102..346 8..245 179 26.9 Plus
Caper-PB 594 CG11266-PB 23..215 93..246 177 33.2 Plus
Caper-PA 594 CG11266-PA 23..215 93..246 177 33.2 Plus
SC35-PD 195 CG5442-PD 27..195 12..185 174 33.9 Plus
SC35-PC 195 CG5442-PC 27..195 12..185 174 33.9 Plus
SC35-PB 195 CG5442-PB 27..195 12..185 174 33.9 Plus
caz-PD 355 CG3606-PD 78..303 10..199 172 27.6 Plus
caz-PC 384 CG3606-PC 107..332 10..199 172 27.6 Plus
caz-PB 399 CG3606-PB 122..347 10..199 172 27.6 Plus
B52-PB 329 CG10851-PB 161..318 49..244 171 33.8 Plus
CNBP-PB 165 CG3800-PB 14..76 81..136 168 55.6 Plus
CNBP-PA 165 CG3800-PA 14..76 81..136 168 55.6 Plus
B52-PI 135 CG10851-PI 5..97 9..96 158 42.7 Plus
B52-PD 135 CG10851-PD 5..97 9..96 158 42.7 Plus
B52-PK 147 CG10851-PK 5..97 9..96 158 42.7 Plus
B52-PF 147 CG10851-PF 5..97 9..96 158 42.7 Plus
RnpS1-PA 374 CG16788-PA 97..216 105..235 157 37.5 Plus
CG9915-PC 820 CG9915-PC 174..356 72..257 155 34.4 Plus
CG9915-PB 820 CG9915-PB 174..356 72..257 155 34.4 Plus
CG9915-PC 820 CG9915-PC 111..319 71..257 154 35.2 Plus
CG9915-PB 820 CG9915-PB 111..319 71..257 154 35.2 Plus
CG9915-PC 820 CG9915-PC 284..461 72..257 153 36.8 Plus
CG9915-PB 820 CG9915-PB 284..461 72..257 153 36.8 Plus
rump-PB 214 CG9373-PB 51..213 2..155 151 34.5 Plus
CG5808-PA 653 CG5808-PA 237..497 5..254 150 27.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15337-PA 151 GI15337-PA 12..81 9..78 242 65.7 Plus
Dmoj\GI23736-PA 137 GI23736-PA 12..81 9..78 239 64.3 Plus
Dmoj\GI19446-PA 196 GI19446-PA 8..78 9..79 207 54.9 Plus
Dmoj\GI24651-PA 246 GI24651-PA 8..81 9..81 143 45.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26725-PA 174 GL26725-PA 12..96 9..93 229 63.5 Plus
Dper\GL25604-PA 140 GL25604-PA 45..140 161..258 222 82.5 Plus
Dper\GL18979-PA 196 GL18979-PA 11..84 9..82 212 54.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30013-PA 259 GA30013-PA 1..259 1..258 685 89.1 Plus
Dpse\GA15173-PA 161 GA15173-PA 12..96 9..93 229 63.5 Plus
Dpse\GA19037-PA 196 GA19037-PA 11..84 9..82 212 54.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13749-PA 138 GM13749-PA 20..138 140..258 526 100 Plus
Dsec\GM13734-PA 226 GM13734-PA 1..86 1..86 458 100 Plus
Dsec\GM23896-PA 144 GM23896-PA 12..81 9..78 241 64.3 Plus
Dsec\GM11879-PA 200 GM11879-PA 11..81 9..79 205 54.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22534-PA 123 GD22534-PA 6..123 141..258 519 100 Plus
Dsim\GD18708-PA 144 GD18708-PA 12..81 9..78 241 64.3 Plus
Dsim\GD22286-PA 200 GD22286-PA 11..81 9..79 205 54.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10582-PA 140 GJ10582-PA 12..85 9..82 256 64.9 Plus
Dvir\GJ17569-PA 113 GJ17569-PA 20..113 159..258 247 77.5 Plus
Dvir\GJ14774-PA 155 GJ14774-PA 12..96 9..93 233 63.5 Plus
Dvir\GJ17527-PA 198 GJ17527-PA 8..78 9..79 203 54.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13897-PA 140 GK13897-PA 12..81 9..78 239 62.9 Plus
Dwil\GK16401-PA 176 GK16401-PA 12..98 9..95 232 63.2 Plus
Dwil\GK12439-PA 192 GK12439-PA 8..78 9..79 204 54.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18395-PA 142 GE18395-PA 43..142 159..258 248 98 Plus
Dyak\GE16161-PA 160 GE16161-PA 12..96 9..93 229 63.5 Plus
Dyak\GE26241-PA 200 GE26241-PA 11..81 9..79 205 54.9 Plus

LD46359.hyp Sequence

Translation from 231 to 1007

> LD46359.hyp
MSRHPSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVE
FESARDAADAVRGLDGRTVCGRRARVELSTGKYARSGGGGGGGGGGGGGG
GLGGRDRGGGGRGDDKCYECGGRGHFARHCRERKARQRRRSNSFSRSRST
SRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNGSG
AVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVRRGSPPRRRGDSS
ASRSVSRD*

LD46359.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
x16-PA 258 CG10203-PA 1..258 1..258 1361 100 Plus
x16-PB 257 CG10203-PB 1..257 1..258 1344 99.6 Plus
Rbp1-like-PC 158 CG1987-PC 12..157 9..163 403 55.5 Plus
Rbp1-like-PA 158 CG1987-PA 12..157 9..163 403 55.5 Plus
Rbp1-like-PB 247 CG1987-PB 12..176 9..164 373 47.3 Plus