Clone LD46404 Report

Search the DGRC for LD46404

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:464
Well:4
Vector:pOT2
Associated Gene/TranscriptCG16753-RA
Protein status:LD46404.pep: gold
Preliminary Size:922
Sequenced Size:761

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16753 2001-01-01 Release 2 assignment
CG16753 2001-10-10 Blastp of sequenced clone
CG16753 2003-01-01 Sim4 clustering to Release 3
CG16753 2008-04-29 Release 5.5 accounting
CG16753 2008-08-15 Release 5.9 accounting
CG16753 2008-12-18 5.12 accounting

Clone Sequence Records

LD46404.complete Sequence

761 bp (761 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061509

> LD46404.complete
CACGCTGCACGTTTGTTTTTATTTTGATTTTGTTGGTGCACAAATCGCAG
TAGAATGGCAAAAACGAAGAAAAATGTAAGGGCCAAGGCGAAAAGCGTGG
TGGGGGCGGCCAAGCAGAAGGCTCAGGACATGAAGGCCAAGCTGCGCGAG
GATCGTCTGCTCCACAAGACCCTTACGCCCAAGAAGACGACCACCAAGAA
GGAGAAATCCGAGGCGAAACACAAGAAGCTGCTCAAGAGATTCGCCGAAG
CGCGTAAGAAACGCAAGGAGGAGCACAAGAATCGCGAGAAGACCAAAGTT
GTCGGAGATCTAAAACCACTGCGGGATGCCCTACCCTCGCTGCAGGACAT
CTACAAGCTGGTGAAGACCAAGCAAAAGGATGTCTCCGAGGGGGCAGCCC
TCACAGAACCAGAGGTCCGACTGAGTGCCAACGAGAAGATCCGGAAAAAA
CGCACTGAAATGGTCAACACCGTCAAGTCCTTCGAAAAGCTCATCAAAGA
CAAGAACTTCAAGAAGAATCCCCGCGAAGTCATCGCCGCCCATGTGCGCA
ACAAGTACCAGGCGATGGAAGAGGACGACTACGAATAGAAGCCTCAAATC
AGCAGATTAATTATTTTTAGGTATAAACATAAATAATACAAGGATTGTAA
AGAAATATACGATGACGCAAGTATGTTAGTCCAAAACTATGAAAAACGTT
ACTAATTGAGCACTGTAAAATAAACTGTGCATATCTAGAACAAAAAAAAA
AAAAAAAAAAA

LD46404.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG16753-RA 743 CG16753-RA 1..743 1..743 3715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3054493..3055235 1..741 3590 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3055102..3055844 1..743 3715 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3055102..3055844 1..743 3715 100 Plus
Blast to na_te.dros performed 2019-03-15 22:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Tirant 8526 Tirant TIRANT 8526bp 6576..6644 656..723 126 66.7 Plus

LD46404.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:33:28 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3054493..3055235 1..741 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:30:04 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
CG16753-RA 1..534 55..588 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:21 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
CG16753-RA 1..534 55..588 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:23:55 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
CG16753-RA 1..534 55..588 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:21 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
CG16753-RA 1..534 55..588 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:26:55 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
CG16753-RA 1..534 55..588 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:35:00 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
CG16753-RA 1..741 1..741 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:20 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
CG16753-RA 1..741 1..741 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:23:55 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
CG16753-RA 24..764 1..741 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:49 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
CG16753-RA 1..741 1..741 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:26:55 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
CG16753-RA 24..764 1..741 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:28 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3055102..3055842 1..741 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:28 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3055102..3055842 1..741 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:28 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3055102..3055842 1..741 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:23:55 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3055102..3055842 1..741 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:56:07 Download gff for LD46404.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3055102..3055842 1..741 100   Plus

LD46404.pep Sequence

Translation from 54 to 587

> LD46404.pep
MAKTKKNVRAKAKSVVGAAKQKAQDMKAKLREDRLLHKTLTPKKTTTKKE
KSEAKHKKLLKRFAEARKKRKEEHKNREKTKVVGDLKPLRDALPSLQDIY
KLVKTKQKDVSEGAALTEPEVRLSANEKIRKKRTEMVNTVKSFEKLIKDK
NFKKNPREVIAAHVRNKYQAMEEDDYE*

LD46404.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24266-PA 178 GF24266-PA 1..177 1..175 684 81.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14902-PA 179 GG14902-PA 1..179 1..177 729 89.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14572-PA 181 GH14572-PA 2..181 4..177 468 68.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG16753-PA 177 CG16753-PA 1..177 1..177 882 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13898-PA 181 GI13898-PA 1..181 1..177 549 66.7 Plus
Dmoj\GI11293-PA 181 GI11293-PA 1..181 1..177 549 66.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20782-PA 179 GL20782-PA 1..178 1..175 515 68.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14127-PA 179 GA14127-PA 1..178 1..175 516 68.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14528-PA 177 GM14528-PA 1..176 1..176 723 92.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13725-PA 175 GD13725-PA 1..175 1..177 632 82.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11754-PA 182 GJ11754-PA 1..182 1..177 535 71 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14899-PA 183 GK14899-PA 1..181 1..175 654 73.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20356-PA 179 GE20356-PA 1..179 1..177 717 88.8 Plus

LD46404.hyp Sequence

Translation from 54 to 587

> LD46404.hyp
MAKTKKNVRAKAKSVVGAAKQKAQDMKAKLREDRLLHKTLTPKKTTTKKE
KSEAKHKKLLKRFAEARKKRKEEHKNREKTKVVGDLKPLRDALPSLQDIY
KLVKTKQKDVSEGAALTEPEVRLSANEKIRKKRTEMVNTVKSFEKLIKDK
NFKKNPREVIAAHVRNKYQAMEEDDYE*

LD46404.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG16753-PA 177 CG16753-PA 1..177 1..177 882 100 Plus