BDGP Sequence Production Resources |
Search the DGRC for LD46404
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 464 |
Well: | 4 |
Vector: | pOT2 |
Associated Gene/Transcript | CG16753-RA |
Protein status: | LD46404.pep: gold |
Preliminary Size: | 922 |
Sequenced Size: | 761 |
Gene | Date | Evidence |
---|---|---|
CG16753 | 2001-01-01 | Release 2 assignment |
CG16753 | 2001-10-10 | Blastp of sequenced clone |
CG16753 | 2003-01-01 | Sim4 clustering to Release 3 |
CG16753 | 2008-04-29 | Release 5.5 accounting |
CG16753 | 2008-08-15 | Release 5.9 accounting |
CG16753 | 2008-12-18 | 5.12 accounting |
761 bp (761 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061509
> LD46404.complete CACGCTGCACGTTTGTTTTTATTTTGATTTTGTTGGTGCACAAATCGCAG TAGAATGGCAAAAACGAAGAAAAATGTAAGGGCCAAGGCGAAAAGCGTGG TGGGGGCGGCCAAGCAGAAGGCTCAGGACATGAAGGCCAAGCTGCGCGAG GATCGTCTGCTCCACAAGACCCTTACGCCCAAGAAGACGACCACCAAGAA GGAGAAATCCGAGGCGAAACACAAGAAGCTGCTCAAGAGATTCGCCGAAG CGCGTAAGAAACGCAAGGAGGAGCACAAGAATCGCGAGAAGACCAAAGTT GTCGGAGATCTAAAACCACTGCGGGATGCCCTACCCTCGCTGCAGGACAT CTACAAGCTGGTGAAGACCAAGCAAAAGGATGTCTCCGAGGGGGCAGCCC TCACAGAACCAGAGGTCCGACTGAGTGCCAACGAGAAGATCCGGAAAAAA CGCACTGAAATGGTCAACACCGTCAAGTCCTTCGAAAAGCTCATCAAAGA CAAGAACTTCAAGAAGAATCCCCGCGAAGTCATCGCCGCCCATGTGCGCA ACAAGTACCAGGCGATGGAAGAGGACGACTACGAATAGAAGCCTCAAATC AGCAGATTAATTATTTTTAGGTATAAACATAAATAATACAAGGATTGTAA AGAAATATACGATGACGCAAGTATGTTAGTCCAAAACTATGAAAAACGTT ACTAATTGAGCACTGTAAAATAAACTGTGCATATCTAGAACAAAAAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG16753-RA | 743 | CG16753-RA | 1..743 | 1..743 | 3715 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 3054493..3055235 | 1..741 | 3590 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 3055102..3055844 | 1..743 | 3715 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 3055102..3055844 | 1..743 | 3715 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tirant | 8526 | Tirant TIRANT 8526bp | 6576..6644 | 656..723 | 126 | 66.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 3054493..3055235 | 1..741 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16753-RA | 1..534 | 55..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16753-RA | 1..534 | 55..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16753-RA | 1..534 | 55..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16753-RA | 1..534 | 55..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16753-RA | 1..534 | 55..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16753-RA | 1..741 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16753-RA | 1..741 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16753-RA | 24..764 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16753-RA | 1..741 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG16753-RA | 24..764 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3055102..3055842 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3055102..3055842 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3055102..3055842 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 3055102..3055842 | 1..741 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3055102..3055842 | 1..741 | 100 | Plus |
Translation from 54 to 587
> LD46404.pep MAKTKKNVRAKAKSVVGAAKQKAQDMKAKLREDRLLHKTLTPKKTTTKKE KSEAKHKKLLKRFAEARKKRKEEHKNREKTKVVGDLKPLRDALPSLQDIY KLVKTKQKDVSEGAALTEPEVRLSANEKIRKKRTEMVNTVKSFEKLIKDK NFKKNPREVIAAHVRNKYQAMEEDDYE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24266-PA | 178 | GF24266-PA | 1..177 | 1..175 | 684 | 81.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14902-PA | 179 | GG14902-PA | 1..179 | 1..177 | 729 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14572-PA | 181 | GH14572-PA | 2..181 | 4..177 | 468 | 68.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG16753-PA | 177 | CG16753-PA | 1..177 | 1..177 | 882 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13898-PA | 181 | GI13898-PA | 1..181 | 1..177 | 549 | 66.7 | Plus |
Dmoj\GI11293-PA | 181 | GI11293-PA | 1..181 | 1..177 | 549 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20782-PA | 179 | GL20782-PA | 1..178 | 1..175 | 515 | 68.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14127-PA | 179 | GA14127-PA | 1..178 | 1..175 | 516 | 68.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14528-PA | 177 | GM14528-PA | 1..176 | 1..176 | 723 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13725-PA | 175 | GD13725-PA | 1..175 | 1..177 | 632 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11754-PA | 182 | GJ11754-PA | 1..182 | 1..177 | 535 | 71 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14899-PA | 183 | GK14899-PA | 1..181 | 1..175 | 654 | 73.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20356-PA | 179 | GE20356-PA | 1..179 | 1..177 | 717 | 88.8 | Plus |
Translation from 54 to 587
> LD46404.hyp MAKTKKNVRAKAKSVVGAAKQKAQDMKAKLREDRLLHKTLTPKKTTTKKE KSEAKHKKLLKRFAEARKKRKEEHKNREKTKVVGDLKPLRDALPSLQDIY KLVKTKQKDVSEGAALTEPEVRLSANEKIRKKRTEMVNTVKSFEKLIKDK NFKKNPREVIAAHVRNKYQAMEEDDYE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG16753-PA | 177 | CG16753-PA | 1..177 | 1..177 | 882 | 100 | Plus |