Clone LD46418 Report

Search the DGRC for LD46418

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:464
Well:18
Vector:pOT2
Associated Gene/TranscriptSras-RA
Protein status:LD46418.pep: gold
Preliminary Size:1398
Sequenced Size:1223

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4852 2001-01-01 Release 2 assignment
CG4852 2003-01-01 Sim4 clustering to Release 3
CG4852 2003-01-15 Blastp of sequenced clone
Sras 2008-04-29 Release 5.5 accounting
Sras 2008-08-15 Release 5.9 accounting
Sras 2008-12-18 5.12 accounting

Clone Sequence Records

LD46418.complete Sequence

1223 bp (1223 high quality bases) assembled on 2003-01-15

GenBank Submission: AY069692

> LD46418.complete
TGACGAATAACACAAATTGAATGAAAAACCTGAGTGAGACGGAAGCCGAA
GTCACCATGCAAGAAAATGTAGTCCACGAATCATTGCCCCAGATCCCGGT
GGCCACTTCGGTGAGCTGTTGCTTCGTTCTGGCTGTTCTGTACGTGGGTA
GCCTCTACATCTGGAGCACCAAACACAACCGGGATCATCCAACCACGGTC
AAGAGAAGATTCGCCAGTGTGTCCATGGTGATGCTGGCAGCCCCGTTCTT
CGTTTACTTCTTCTCATCGCCGGAGCTGCTCAGCCGGGTACCATTTCCCA
AGCTGCTCGGTTTGCGCTTGGAGGGATTGTGGCAGGCTGTTGTTATACCA
TACAGCCTGACGGTGCTGCTCTTCCTGGGACCCATCTTTGTCAACATGCA
GAACGAGTCCGTGCGCTCCTACTTCGATCTGGACTACTGGAGGGGATCAT
TTGGCAGCATCATCTGGGTGCGCAACCATGTGATAGCACCGCTGAGCGAG
GAGTTCGTGTTCCGAGCCTGCATGATGCCCCTGATCCTGCAGAGCTTTTC
GCCCCTGGTCGCCGTTTTCATAACGCCGCTTTTCTTCGGAGTAGCCCACT
TGCATCACATAGCCGAACGCCTGAGCTTAGGCGTGGAGTTGAGCACTGCC
CTATTGATTGGACTGTTCCAGTTCATCTACACCACGCTATTTGGCTTCTA
TTCGGCCTTTCTATTTGCCCGTACAGGTCATGTGATGGCTCCCATCTTGG
TGCACGCGTTTTGCAATCACATGGGTCTGCCGGATCTGCAGGATCTGTGG
CAGCAGGATCTCTGGCGACGAGTAGTGGCCATTATTCTCTACTTAGCTGG
ATTTGTTGGATGGATGTTCCTGGTACCACTGGCTACCGATCCGTCGATCT
ATGATAACACCCTTTACTGGAATGCATAATTAAGTTAATTTGTATGTATC
AACCGCTGCCATACGTCGGTTCATTCATGTGTACATAAATATTCGTGCAT
ATATTATGTTTATATGTAAATTGCATATCCCATTCGAGCCAATTCCGCGC
ACAAAAAAAAGACTTCCGATGAAAAAGAAAAAAGAAAGTACAGATAAATG
TATACCTAATAGTAAGTCAGTTGTACTGTTTTGTTGTTCGAGAGTACTTT
TATTACAACTACTTTTGTTTGCATTTGTTTATTAAACAATTTCTTAACAT
TTATAAAAAAAAAAAAAAAAAAA

LD46418.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Sras-RA 1365 Sras-RA 162..1365 1..1204 6005 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5556915..5557694 426..1204 3820 99.6 Plus
chr3L 24539361 chr3L 5556431..5556856 1..426 2130 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5564325..5565106 426..1207 3895 99.9 Plus
3L 28110227 3L 5563841..5564266 1..426 2130 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5557425..5558206 426..1207 3895 99.8 Plus
3L 28103327 3L 5556941..5557366 1..426 2130 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:25:26 has no hits.

LD46418.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:26:29 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5556431..5556856 1..426 100 -> Plus
chr3L 5556916..5557688 427..1198 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:30:05 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
Sras-RA 1..909 21..929 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:20 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
Sras-RA 1..909 21..929 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:47:48 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
Sras-RA 1..909 21..929 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:17 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
Sras-RA 1..909 21..929 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:38 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
Sras-RA 1..909 21..929 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:12:02 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
Sras-RA 162..1365 1..1204 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:20 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
Sras-RA 162..1365 1..1204 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:47:48 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
Sras-RA 68..1271 1..1204 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:17 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
Sras-RA 162..1365 1..1204 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:38 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
Sras-RA 68..1271 1..1204 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:29 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5563841..5564266 1..426 100 -> Plus
3L 5564326..5565103 427..1204 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:29 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5563841..5564266 1..426 100 -> Plus
3L 5564326..5565103 427..1204 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:29 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5563841..5564266 1..426 100 -> Plus
3L 5564326..5565103 427..1204 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:47:48 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5556941..5557366 1..426 100 -> Plus
arm_3L 5557426..5558203 427..1204 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:30 Download gff for LD46418.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5556941..5557366 1..426 100 -> Plus
3L 5557426..5558203 427..1204 99   Plus

LD46418.pep Sequence

Translation from 20 to 928

> LD46418.pep
MKNLSETEAEVTMQENVVHESLPQIPVATSVSCCFVLAVLYVGSLYIWST
KHNRDHPTTVKRRFASVSMVMLAAPFFVYFFSSPELLSRVPFPKLLGLRL
EGLWQAVVIPYSLTVLLFLGPIFVNMQNESVRSYFDLDYWRGSFGSIIWV
RNHVIAPLSEEFVFRACMMPLILQSFSPLVAVFITPLFFGVAHLHHIAER
LSLGVELSTALLIGLFQFIYTTLFGFYSAFLFARTGHVMAPILVHAFCNH
MGLPDLQDLWQQDLWRRVVAIILYLAGFVGWMFLVPLATDPSIYDNTLYW
NA*

LD46418.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23981-PA 305 GF23981-PA 1..304 1..301 1368 84.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15273-PA 302 GG15273-PA 1..301 1..301 1530 95.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15194-PA 302 GH15194-PA 1..300 1..301 1277 78.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Sras-PA 302 CG4852-PA 1..302 1..302 1584 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12131-PA 294 GI12131-PA 11..293 19..301 1201 77 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12258-PA 188 GL12258-PA 1..187 115..301 856 83.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18479-PA 300 GA18479-PA 17..299 19..301 1265 81.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14706-PA 302 GM14706-PA 1..302 1..302 1532 95.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13889-PA 302 GD13889-PA 1..302 1..302 1535 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13405-PA 294 GJ13405-PA 13..293 21..301 1227 80.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16882-PA 301 GK16882-PA 1..300 1..301 1235 76.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21494-PA 302 GE21494-PA 1..301 1..301 1535 95.3 Plus

LD46418.hyp Sequence

Translation from 20 to 928

> LD46418.hyp
MKNLSETEAEVTMQENVVHESLPQIPVATSVSCCFVLAVLYVGSLYIWST
KHNRDHPTTVKRRFASVSMVMLAAPFFVYFFSSPELLSRVPFPKLLGLRL
EGLWQAVVIPYSLTVLLFLGPIFVNMQNESVRSYFDLDYWRGSFGSIIWV
RNHVIAPLSEEFVFRACMMPLILQSFSPLVAVFITPLFFGVAHLHHIAER
LSLGVELSTALLIGLFQFIYTTLFGFYSAFLFARTGHVMAPILVHAFCNH
MGLPDLQDLWQQDLWRRVVAIILYLAGFVGWMFLVPLATDPSIYDNTLYW
NA*

LD46418.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:00:02
Subject Length Description Subject Range Query Range Score Percent Strand
Sras-PA 302 CG4852-PA 1..302 1..302 1584 100 Plus