Clone LD46483 Report

Search the DGRC for LD46483

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:464
Well:83
Vector:pOT2
Associated Gene/TranscriptHmg-2-RA
Protein status:LD46483.pep: gold
Preliminary Size:1449
Sequenced Size:1349

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9418 2001-09-19 Blastp of sequenced clone
CG9418 2008-04-29 Release 5.5 accounting
CG9418 2008-08-15 Release 5.9 accounting
CG9418 2008-12-18 5.12 accounting

Clone Sequence Records

LD46483.complete Sequence

1349 bp (1349 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058722

> LD46483.complete
TTTTGCTTACGAACCACATACCTGTGATTTTGCAGAAAGATAAACAATTT
TTAAATGCAATAGAGTGTACGGTTAAACAGAAATGACGGAACCAACGAGC
AAGACACCGGATGCGGTTCCGGAATCACCCGTATCACTGCCCATCGCCTC
CCAATCCATGGATACGGCGACCATTGAAGATTTCGACGAGGACAAACCGG
CCAAGGGAAAGAAGAAAGCCAAGAATCCAAAGGGTCGCCACTCGGATTCC
GACATCGGCTCCGAACTGAAGAAGCTGGCCCAGCGCCGGATCAACGTAGC
CGGTGCTCCAAAAATGCCACTTAATGGCTACGTCCGCTTCATGAACGATC
GACGCGAGGAACTGCGACGGGAGCAGCCACAACGTACTGCCCTGGAGCAC
ACAAGGATCATCGGCGAGGAGTGGCATCAGCTGCCCGAGGAGCGCAAGTT
GCCCTACATCGAGGCAGCCGCCAAGGACAAGGCCATATATCAGGAGCAGT
TGCAAATGTTTCTCAAGGAACACCCCGAAATTGTGGCCAACGAGTTGGCC
AAAGCCAAGAAAGCCACAAAACTGGATGGTTCGCCCAAGGAAAAGACGCC
GAAGGGTGAATCAGCCTTGGGCAAGGCGAAGAAGACCAAGGCAAAGCCGG
TTAAGCGGCAGAGCGAGGATCCGGATGATGTGCCTCTGGCCAAGGTGAAG
CGTGCCCAGACACCACCGCCTCCCACACCGCCAGCGGCTCCAGTACAGCC
CCCTCCCAGCAGCGTGCCACCTGCGACACCTGCACCACGACCGCTGCAGC
CCGGCGAGATACCCATCTACACCAACGAGTTCATCGAACACAATCGCAGC
ACGGAGAATGAGCTGAGGACGCTGCGCAAGGCCAAGACCGATCTGGAGCA
GCAGAACGCTGTGCTGGAACAGCACGTAGATAATACGAAAGCCGGGTACG
CCAAGGTGATGGGCGAGGTAACTGAGCTCATGGAGGAGAACCAACGCCTG
GAGACCTATTTGCGCGCCTTGCGCCAGAAACTGGTCGCAGCTCTCGGCGG
AATCTCGATGCCACCACTGGAGCCAAGTGGTCCCAGCGTTGGCAACATTG
ACAAGTACATCCGGCACTTAGCCGGGCTCGTCACTCAGCCAAGCAACGTC
ACTTTGATTAAGGCACGAGAGGCGCTGCGTAAAGTGGACACCAGTAGCTT
GCTAAAACCGTGATTCATAGTACAGTATTCATAGCGTTAATAACTTCACC
ATAAACAATAGTCATAGTCATAGAACAATAGTTATCAATGCCAAGGATAT
CAAAAGAGAAAACCGAATAACAATAAAATATAAAAAAAAAAAAAAAAAA

LD46483.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9418-RA 1394 CG9418-RA 43..1373 1..1331 6655 100 Plus
CG15657-RA 673 CG15657-RA 543..673 1331..1201 655 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17033220..17034063 487..1331 4010 98.6 Plus
chr2R 21145070 chr2R 17032675..17033160 1..486 2280 97.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:42:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21146764..21147608 487..1331 4225 100 Plus
2R 25286936 2R 21146219..21146704 1..486 2430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21147963..21148807 487..1331 4225 100 Plus
2R 25260384 2R 21147418..21147903 1..486 2430 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:09:01 has no hits.

LD46483.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:10:08 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17032675..17033160 1..486 97 -> Plus
chr2R 17033220..17034063 487..1331 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:30:10 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9418-RA 1..1131 83..1213 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:59:00 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9418-RA 1..1131 83..1213 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:01:24 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9418-RA 1..1131 83..1213 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:29:22 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9418-RA 1..1131 83..1213 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:28:32 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
Hmg-2-RA 1..1131 83..1213 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:45:59 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9418-RA 12..1342 1..1331 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:58:59 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9418-RA 12..1342 1..1331 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:01:24 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9418-RA 17..1347 1..1331 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:29:22 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9418-RA 12..1342 1..1331 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:28:32 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
Hmg-2-RA 17..1347 1..1331 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:08 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21146219..21146704 1..486 100 -> Plus
2R 21146764..21147608 487..1331 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:08 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21146219..21146704 1..486 100 -> Plus
2R 21146764..21147608 487..1331 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:08 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21146219..21146704 1..486 100 -> Plus
2R 21146764..21147608 487..1331 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:01:24 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17033724..17034209 1..486 100 -> Plus
arm_2R 17034269..17035113 487..1331 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:05:40 Download gff for LD46483.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21147418..21147903 1..486 100 -> Plus
2R 21147963..21148807 487..1331 100   Plus

LD46483.pep Sequence

Translation from 82 to 1212

> LD46483.pep
MTEPTSKTPDAVPESPVSLPIASQSMDTATIEDFDEDKPAKGKKKAKNPK
GRHSDSDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQ
RTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFLKEHPEI
VANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQSEDPDDV
PLAKVKRAQTPPPPTPPAAPVQPPPSSVPPATPAPRPLQPGEIPIYTNEF
IEHNRSTENELRTLRKAKTDLEQQNAVLEQHVDNTKAGYAKVMGEVTELM
EENQRLETYLRALRQKLVAALGGISMPPLEPSGPSVGNIDKYIRHLAGLV
TQPSNVTLIKAREALRKVDTSSLLKP*

LD46483.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11938-PA 374 GF11938-PA 1..374 1..376 1251 70.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22094-PA 373 GG22094-PA 1..373 1..376 1614 91.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20725-PA 413 GH20725-PA 70..412 51..376 1010 58.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Hmg-2-PA 376 CG9418-PA 1..376 1..376 1931 100 Plus
Ssrp-PA 723 CG4817-PA 482..703 3..214 161 25.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20809-PA 388 GI20809-PA 44..388 56..376 1014 59.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10158-PA 340 GL10158-PA 1..339 1..375 1112 61.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21773-PA 396 GA21773-PA 1..395 1..375 1184 65.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15811-PA 376 GM15811-PA 1..376 1..376 1896 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11569-PA 376 GD11569-PA 1..376 1..376 1899 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20542-PA 397 GJ20542-PA 13..397 8..376 1005 58.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19656-PA 387 GK19656-PA 77..383 52..369 1059 68.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12173-PA 373 GE12173-PA 1..373 1..376 1571 89.1 Plus

LD46483.hyp Sequence

Translation from 82 to 1212

> LD46483.hyp
MTEPTSKTPDAVPESPVSLPIASQSMDTATIEDFDEDKPAKGKKKAKNPK
GRHSDSDIGSELKKLAQRRINVAGAPKMPLNGYVRFMNDRREELRREQPQ
RTALEHTRIIGEEWHQLPEERKLPYIEAAAKDKAIYQEQLQMFLKEHPEI
VANELAKAKKATKLDGSPKEKTPKGESALGKAKKTKAKPVKRQSEDPDDV
PLAKVKRAQTPPPPTPPAAPVQPPPSSVPPATPAPRPLQPGEIPIYTNEF
IEHNRSTENELRTLRKAKTDLEQQNAVLEQHVDNTKAGYAKVMGEVTELM
EENQRLETYLRALRQKLVAALGGISMPPLEPSGPSVGNIDKYIRHLAGLV
TQPSNVTLIKAREALRKVDTSSLLKP*

LD46483.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Hmg-2-PA 376 CG9418-PA 1..376 1..376 1931 100 Plus
Ssrp-PA 723 CG4817-PA 482..703 3..214 161 25.3 Plus