Clone LD46678 Report

Search the DGRC for LD46678

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:466
Well:78
Vector:pOT2
Associated Gene/TranscriptCG10053-RA
Protein status:LD46678.pep: gold
Preliminary Size:1048
Sequenced Size:852

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10053 2001-01-01 Release 2 assignment
CG10053 2001-10-10 Blastp of sequenced clone
CG10053 2003-01-01 Sim4 clustering to Release 3
CG10053 2008-04-29 Release 5.5 accounting
CG10053 2008-08-15 Release 5.9 accounting
CG10053 2008-12-18 5.12 accounting

Clone Sequence Records

LD46678.complete Sequence

852 bp (852 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061511

> LD46678.complete
AACAAACAGATGTCTGACGAGGAGGAGGATTATATGTCCGACAAATTCCT
GGTTGGTCTGCAAGATGTCCGACCGAGTTTGGTGCACAATCGCGGCAGAA
AGCGGCAGATTGAAGTCGAGTCCAAGAAAGATGAGCTGAAGAAGCGCCAA
CGGGAGACAGCAGCTTCTTCCGGGAACGTAGACAATGTTCGCCTTCAACA
GTCCCTCAACAAACCAATTTCCGCCGACAACAAAGGATTCCAGCTACTGG
CCAAGATGGGCTACAAAGCCGGTTCTGGGTTGGGCATAACTTCGGATGCT
CGTACTGAACCCGTGGGGATAACTATAAAGAGCGGTCGTGGAGGACTTGG
GCGCGAGGCAGCCGTTGCAGAGTTGGCCCTCAAGCGGCAGAAGTTGCGGA
GGGCACATCTCCTAAACAAGGCCGGCATTAAAAGCGACGAGGAAGTCAGT
ACAGAGGCTTATAGGAGGCGCGCGACCCATAAAGCGGAGGAGCGAAAATT
ACAGTATGACATAAAACGGTGCCAGCAGACCTGCGAATCGTTGGATCTTA
AGTCCGCTATCACAGAACCAGATCTCGATTTCTTTTGGCCACCTAAACCA
AAAGATGAAGATGAATCACAGAGCGACGCCGACGATCCTGAAGTCGAGGT
GCCACCTAAGCAAGAACCATACAGTCCCTCGGAGCAATTAGAACTCCTCA
CTGGCTACCTGCGCACAGCCTATTGCTTCTGCTATTGGTGTGGGACCCAT
TACGATGACGCCGAAGATCTGGGCTCCAACTGTCCAGGACTCACTCGTGA
CGAACACTAGCTCCAATCAATAAAATAAAATAAAAAAAAAAAAAAAAAAA
AA

LD46678.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG10053-RA 1023 CG10053-RA 152..989 1..838 4190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3073449..3074224 56..831 3880 100 Plus
chr3R 27901430 chr3R 3073325..3073380 1..56 280 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:43:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7247365..7248147 56..838 3915 100 Plus
3R 32079331 3R 7247241..7247296 1..56 280 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6988196..6988978 56..838 3915 100 Plus
3R 31820162 3R 6988072..6988127 1..56 280 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:13:17 has no hits.

LD46678.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:14:04 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3073325..3073380 1..56 100 -> Plus
chr3R 3073450..3074224 57..831 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:30:27 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
CG10053-RA 1..801 10..810 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:11 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
CG10053-RA 1..801 10..810 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:56:02 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
CG10053-RA 1..801 10..810 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:06 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
CG10053-RA 1..801 10..810 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:29:39 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
CG10053-RA 1..801 10..810 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:49 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
CG10053-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:11 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
CG10053-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:56:02 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
CG10053-RA 26..856 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:19:06 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
CG10053-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:29:39 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
CG10053-RA 26..856 1..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:14:04 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7247241..7247296 1..56 100 -> Plus
3R 7247366..7248140 57..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:14:04 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7247241..7247296 1..56 100 -> Plus
3R 7247366..7248140 57..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:14:04 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7247241..7247296 1..56 100 -> Plus
3R 7247366..7248140 57..831 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:56:02 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3072963..3073018 1..56 100 -> Plus
arm_3R 3073088..3073862 57..831 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:54 Download gff for LD46678.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6988197..6988971 57..831 100   Plus
3R 6988072..6988127 1..56 100 -> Plus

LD46678.hyp Sequence

Translation from 0 to 809

> LD46678.hyp
NKQMSDEEEDYMSDKFLVGLQDVRPSLVHNRGRKRQIEVESKKDELKKRQ
RETAASSGNVDNVRLQQSLNKPISADNKGFQLLAKMGYKAGSGLGITSDA
RTEPVGITIKSGRGGLGREAAVAELALKRQKLRRAHLLNKAGIKSDEEVS
TEAYRRRATHKAEERKLQYDIKRCQQTCESLDLKSAITEPDLDFFWPPKP
KDEDESQSDADDPEVEVPPKQEPYSPSEQLELLTGYLRTAYCFCYWCGTH
YDDAEDLGSNCPGLTRDEH*

LD46678.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG10053-PB 266 CG10053-PB 1..266 4..269 1394 100 Plus
CG10053-PA 266 CG10053-PA 1..266 4..269 1394 100 Plus

LD46678.pep Sequence

Translation from 9 to 809

> LD46678.pep
MSDEEEDYMSDKFLVGLQDVRPSLVHNRGRKRQIEVESKKDELKKRQRET
AASSGNVDNVRLQQSLNKPISADNKGFQLLAKMGYKAGSGLGITSDARTE
PVGITIKSGRGGLGREAAVAELALKRQKLRRAHLLNKAGIKSDEEVSTEA
YRRRATHKAEERKLQYDIKRCQQTCESLDLKSAITEPDLDFFWPPKPKDE
DESQSDADDPEVEVPPKQEPYSPSEQLELLTGYLRTAYCFCYWCGTHYDD
AEDLGSNCPGLTRDEH*

LD46678.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:17:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17665-PA 267 GF17665-PA 1..267 1..266 1032 74.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13952-PA 266 GG13952-PA 1..266 1..266 1294 91.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18296-PA 266 GH18296-PA 1..266 1..266 994 69.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG10053-PB 266 CG10053-PB 1..266 1..266 1394 100 Plus
CG10053-PA 266 CG10053-PA 1..266 1..266 1394 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24107-PA 264 GI24107-PA 1..264 1..266 944 69.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12431-PA 269 GL12431-PA 1..269 1..266 1019 71.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10036-PA 269 GA10036-PA 1..269 1..266 1012 71.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10944-PA 266 GM10944-PA 1..266 1..266 1322 92.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19924-PA 266 GD19924-PA 1..266 1..266 1337 93.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10930-PA 266 GJ10930-PA 1..266 1..266 981 70.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10821-PA 264 GK10821-PA 1..264 1..266 872 63.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24915-PA 265 GE24915-PA 1..265 1..266 1280 90.6 Plus
Dyak\GE11178-PA 265 GE11178-PA 1..265 1..266 1272 89.8 Plus