Clone LD46714 Report

Search the DGRC for LD46714

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:467
Well:14
Vector:pOT2
Associated Gene/TranscriptPex2-RA
Protein status:LD46714.pep: gold
Preliminary Size:1149
Sequenced Size:1041

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7081 2001-01-01 Release 2 assignment
CG7081 2003-01-01 Sim4 clustering to Release 3
CG7081 2003-01-15 Blastp of sequenced clone
CG7081 2008-04-29 Release 5.5 accounting
CG7081 2008-08-15 Release 5.9 accounting
CG7081 2008-12-18 5.12 accounting

Clone Sequence Records

LD46714.complete Sequence

1041 bp (1041 high quality bases) assembled on 2003-01-15

GenBank Submission: AY061512

> LD46714.complete
AGAAAGGGCAGAGTACATATAAATAAGAAATATATCAATGGTCAGCTAAC
CAAAGGCAAGAATATAAACAAAATAATGGAGAAAAACAAATATGTACCAC
GTGTAAATCAGATAGATGCCATCTATTTGAACAAGGACATTGCCCGCCTG
ATACGCGATAATCTGCTGGAGAACTTGCAAGCCATCTCACCCGTTTTGTT
CATCAAAATCCAACCGGAGCTCGACTTGATCATTCAATCCGCAATTTGGT
TTGGTTCCGTCGGCAAGCGGTGCTCCACTTTTGGCCAACAGCTACTGGTT
CTGGCTTACGATGCCGAAAAGCTGACCGTTTCCAGGCTGGTGCTCCATTT
CATCCTGACCGTCTTGCCGGGCTACGTGAAGAGCTGGGAGGAGCGACGCT
TAACAAGGCGCGTAGAATGGTTTAGCGAGGCGATTATGTGGGTGGAGAAC
AGTGCCCTGATACTGAACATCCTCAATTACTTTCGGTTCCTGAAGACAGG
ACGAAAACCCACTTTGGTGGACTACTTATTGGGATTGGACTACATTAGTC
TGCGGAACAATCAAAGGAGAGACATTGGCTACAAGTACCTAACGAGGGAG
CTGCTGTGGGGAGGATTTATGGAAATCCTCGGACTGGTGTTGCCCATCAT
CAATTTCCGTAAGCTACAAAGAGTGCTAAAATCATGGACATTTTCCGGAC
GACGGTTAGAGGATAGAGATGGTCCGGCTTTCCTGGCGCCGCAGATGACA
CTAAGCACCACCTGCACATTCTGTGGAGAGCGACCCACATTGCCCCACCA
CATGGGCTGTGGTCATATTTATTGCTATTACTGCCTTAATGCAAATGTTT
TAACGGATGCCAGTTTCTGCTGCCCCAACTGCGGTTCTGCGTGTCCTGAG
TCGGGAATCCAAAGTGTCTGATAAATAGGAATATAGTGCATGTGATGGTT
TTATATGTCTTTTATTAGTTTTAAGCGAAAAGTGGGCTGTAAGTAATAAA
CAAATCATTTTCATATTCCGCCAAAAAAAAAAAAAAAAAAA

LD46714.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG7081-RA 1057 CG7081-RA 32..1056 1..1025 5125 100 Plus
CG7081.a 1071 CG7081.a 156..1070 111..1025 4575 100 Plus
CG7081.a 1071 CG7081.a 32..142 1..111 555 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8331431..8331863 190..622 2120 99.3 Plus
chr3L 24539361 chr3L 8331916..8332317 621..1022 1995 99.8 Plus
chr3L 24539361 chr3L 8331121..8331231 1..111 555 100 Plus
chr3L 24539361 chr3L 8331296..8331375 110..189 400 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:43:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8339390..8339822 190..622 2165 100 Plus
3L 28110227 3L 8339875..8340279 621..1025 2025 100 Plus
3L 28110227 3L 8339080..8339190 1..111 555 100 Plus
3L 28110227 3L 8339255..8339334 110..189 400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8332490..8332922 190..622 2165 100 Plus
3L 28103327 3L 8332975..8333379 621..1025 2025 100 Plus
3L 28103327 3L 8332180..8332290 1..111 555 100 Plus
3L 28103327 3L 8332355..8332434 110..189 400 100 Plus
Blast to na_te.dros performed 2019-03-16 04:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 5245..5297 23..76 114 70.4 Plus
TAHRE 10463 TAHRE OSV 10463bp 8057..8116 27..86 111 65 Plus
TAHRE 10463 TAHRE OSV 10463bp 8561..8611 27..77 111 68.6 Plus

LD46714.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:32:02 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8331121..8331231 1..111 100 -> Plus
chr3L 8331298..8331375 112..189 100 -> Plus
chr3L 8331431..8331862 190..621 99 -> Plus
chr3L 8331917..8332317 622..1022 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:30:29 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
CG7081-RA 1..846 76..921 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:05 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
pex2-RA 1..846 76..921 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:32:16 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
Pex2-RA 1..846 76..921 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:01 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
CG7081-RA 1..846 76..921 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:42:10 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
Pex2-RA 1..846 76..921 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:11:40 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
CG7081-RA 28..1049 1..1022 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:05 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
pex2-RA 28..1049 1..1022 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:32:16 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
Pex2-RA 30..1051 1..1022 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:01 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
CG7081-RA 28..1049 1..1022 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:42:10 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
Pex2-RA 30..1051 1..1022 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:32:02 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8339080..8339190 1..111 100 -> Plus
3L 8339257..8339334 112..189 100 -> Plus
3L 8339390..8339821 190..621 100 -> Plus
3L 8339876..8340276 622..1022 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:32:02 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8339080..8339190 1..111 100 -> Plus
3L 8339257..8339334 112..189 100 -> Plus
3L 8339390..8339821 190..621 100 -> Plus
3L 8339876..8340276 622..1022 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:32:02 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8339080..8339190 1..111 100 -> Plus
3L 8339257..8339334 112..189 100 -> Plus
3L 8339390..8339821 190..621 100 -> Plus
3L 8339876..8340276 622..1022 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:32:16 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8332180..8332290 1..111 100 -> Plus
arm_3L 8332357..8332434 112..189 100 -> Plus
arm_3L 8332490..8332921 190..621 100 -> Plus
arm_3L 8332976..8333376 622..1022 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:14 Download gff for LD46714.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8332490..8332921 190..621 100 -> Plus
3L 8332976..8333376 622..1022 100   Plus
3L 8332180..8332290 1..111 100 -> Plus
3L 8332357..8332434 112..189 100 -> Plus

LD46714.hyp Sequence

Translation from 0 to 920

> LD46714.hyp
RKGRVHINKKYINGQLTKGKNINKIMEKNKYVPRVNQIDAIYLNKDIARL
IRDNLLENLQAISPVLFIKIQPELDLIIQSAIWFGSVGKRCSTFGQQLLV
LAYDAEKLTVSRLVLHFILTVLPGYVKSWEERRLTRRVEWFSEAIMWVEN
SALILNILNYFRFLKTGRKPTLVDYLLGLDYISLRNNQRRDIGYKYLTRE
LLWGGFMEILGLVLPIINFRKLQRVLKSWTFSGRRLEDRDGPAFLAPQMT
LSTTCTFCGERPTLPHHMGCGHIYCYYCLNANVLTDASFCCPNCGSACPE
SGIQSV*

LD46714.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Pex2-PA 281 CG7081-PA 1..281 26..306 1490 100 Plus

LD46714.pep Sequence

Translation from 75 to 920

> LD46714.pep
MEKNKYVPRVNQIDAIYLNKDIARLIRDNLLENLQAISPVLFIKIQPELD
LIIQSAIWFGSVGKRCSTFGQQLLVLAYDAEKLTVSRLVLHFILTVLPGY
VKSWEERRLTRRVEWFSEAIMWVENSALILNILNYFRFLKTGRKPTLVDY
LLGLDYISLRNNQRRDIGYKYLTRELLWGGFMEILGLVLPIINFRKLQRV
LKSWTFSGRRLEDRDGPAFLAPQMTLSTTCTFCGERPTLPHHMGCGHIYC
YYCLNANVLTDASFCCPNCGSACPESGIQSV*

LD46714.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10289-PA 287 GF10289-PA 2..287 1..281 1305 85.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14303-PA 285 GG14303-PA 1..285 1..281 1448 95.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15055-PA 286 GH15055-PA 2..286 1..281 1238 80 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Pex2-PA 281 CG7081-PA 1..281 1..281 1490 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12821-PA 286 GI12821-PA 2..286 1..281 1223 78.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24695-PA 285 GL24695-PA 2..285 1..281 1299 85.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20087-PA 285 GA20087-PA 2..285 1..281 1299 85.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25045-PA 285 GM25045-PA 1..285 1..281 1463 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14082-PA 285 GD14082-PA 1..285 1..281 1463 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12964-PA 286 GJ12964-PA 2..286 1..281 1259 81.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11933-PA 282 GK11933-PA 2..282 1..281 1287 83.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20731-PA 285 GE20731-PA 1..285 1..281 1439 94.4 Plus