BDGP Sequence Production Resources |
Search the DGRC for LD46714
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 467 |
Well: | 14 |
Vector: | pOT2 |
Associated Gene/Transcript | Pex2-RA |
Protein status: | LD46714.pep: gold |
Preliminary Size: | 1149 |
Sequenced Size: | 1041 |
Gene | Date | Evidence |
---|---|---|
CG7081 | 2001-01-01 | Release 2 assignment |
CG7081 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7081 | 2003-01-15 | Blastp of sequenced clone |
CG7081 | 2008-04-29 | Release 5.5 accounting |
CG7081 | 2008-08-15 | Release 5.9 accounting |
CG7081 | 2008-12-18 | 5.12 accounting |
1041 bp (1041 high quality bases) assembled on 2003-01-15
GenBank Submission: AY061512
> LD46714.complete AGAAAGGGCAGAGTACATATAAATAAGAAATATATCAATGGTCAGCTAAC CAAAGGCAAGAATATAAACAAAATAATGGAGAAAAACAAATATGTACCAC GTGTAAATCAGATAGATGCCATCTATTTGAACAAGGACATTGCCCGCCTG ATACGCGATAATCTGCTGGAGAACTTGCAAGCCATCTCACCCGTTTTGTT CATCAAAATCCAACCGGAGCTCGACTTGATCATTCAATCCGCAATTTGGT TTGGTTCCGTCGGCAAGCGGTGCTCCACTTTTGGCCAACAGCTACTGGTT CTGGCTTACGATGCCGAAAAGCTGACCGTTTCCAGGCTGGTGCTCCATTT CATCCTGACCGTCTTGCCGGGCTACGTGAAGAGCTGGGAGGAGCGACGCT TAACAAGGCGCGTAGAATGGTTTAGCGAGGCGATTATGTGGGTGGAGAAC AGTGCCCTGATACTGAACATCCTCAATTACTTTCGGTTCCTGAAGACAGG ACGAAAACCCACTTTGGTGGACTACTTATTGGGATTGGACTACATTAGTC TGCGGAACAATCAAAGGAGAGACATTGGCTACAAGTACCTAACGAGGGAG CTGCTGTGGGGAGGATTTATGGAAATCCTCGGACTGGTGTTGCCCATCAT CAATTTCCGTAAGCTACAAAGAGTGCTAAAATCATGGACATTTTCCGGAC GACGGTTAGAGGATAGAGATGGTCCGGCTTTCCTGGCGCCGCAGATGACA CTAAGCACCACCTGCACATTCTGTGGAGAGCGACCCACATTGCCCCACCA CATGGGCTGTGGTCATATTTATTGCTATTACTGCCTTAATGCAAATGTTT TAACGGATGCCAGTTTCTGCTGCCCCAACTGCGGTTCTGCGTGTCCTGAG TCGGGAATCCAAAGTGTCTGATAAATAGGAATATAGTGCATGTGATGGTT TTATATGTCTTTTATTAGTTTTAAGCGAAAAGTGGGCTGTAAGTAATAAA CAAATCATTTTCATATTCCGCCAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 8331431..8331863 | 190..622 | 2120 | 99.3 | Plus |
chr3L | 24539361 | chr3L | 8331916..8332317 | 621..1022 | 1995 | 99.8 | Plus |
chr3L | 24539361 | chr3L | 8331121..8331231 | 1..111 | 555 | 100 | Plus |
chr3L | 24539361 | chr3L | 8331296..8331375 | 110..189 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 8339390..8339822 | 190..622 | 2165 | 100 | Plus |
3L | 28110227 | 3L | 8339875..8340279 | 621..1025 | 2025 | 100 | Plus |
3L | 28110227 | 3L | 8339080..8339190 | 1..111 | 555 | 100 | Plus |
3L | 28110227 | 3L | 8339255..8339334 | 110..189 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 8332490..8332922 | 190..622 | 2165 | 100 | Plus |
3L | 28103327 | 3L | 8332975..8333379 | 621..1025 | 2025 | 100 | Plus |
3L | 28103327 | 3L | 8332180..8332290 | 1..111 | 555 | 100 | Plus |
3L | 28103327 | 3L | 8332355..8332434 | 110..189 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
17.6 | 7439 | 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). | 5245..5297 | 23..76 | 114 | 70.4 | Plus |
TAHRE | 10463 | TAHRE OSV 10463bp | 8057..8116 | 27..86 | 111 | 65 | Plus |
TAHRE | 10463 | TAHRE OSV 10463bp | 8561..8611 | 27..77 | 111 | 68.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8331121..8331231 | 1..111 | 100 | -> | Plus |
chr3L | 8331298..8331375 | 112..189 | 100 | -> | Plus |
chr3L | 8331431..8331862 | 190..621 | 99 | -> | Plus |
chr3L | 8331917..8332317 | 622..1022 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7081-RA | 1..846 | 76..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pex2-RA | 1..846 | 76..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pex2-RA | 1..846 | 76..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7081-RA | 1..846 | 76..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pex2-RA | 1..846 | 76..921 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7081-RA | 28..1049 | 1..1022 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pex2-RA | 28..1049 | 1..1022 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pex2-RA | 30..1051 | 1..1022 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7081-RA | 28..1049 | 1..1022 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pex2-RA | 30..1051 | 1..1022 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8339080..8339190 | 1..111 | 100 | -> | Plus |
3L | 8339257..8339334 | 112..189 | 100 | -> | Plus |
3L | 8339390..8339821 | 190..621 | 100 | -> | Plus |
3L | 8339876..8340276 | 622..1022 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8339080..8339190 | 1..111 | 100 | -> | Plus |
3L | 8339257..8339334 | 112..189 | 100 | -> | Plus |
3L | 8339390..8339821 | 190..621 | 100 | -> | Plus |
3L | 8339876..8340276 | 622..1022 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8339080..8339190 | 1..111 | 100 | -> | Plus |
3L | 8339257..8339334 | 112..189 | 100 | -> | Plus |
3L | 8339390..8339821 | 190..621 | 100 | -> | Plus |
3L | 8339876..8340276 | 622..1022 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8332180..8332290 | 1..111 | 100 | -> | Plus |
arm_3L | 8332357..8332434 | 112..189 | 100 | -> | Plus |
arm_3L | 8332490..8332921 | 190..621 | 100 | -> | Plus |
arm_3L | 8332976..8333376 | 622..1022 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8332490..8332921 | 190..621 | 100 | -> | Plus |
3L | 8332976..8333376 | 622..1022 | 100 | Plus | |
3L | 8332180..8332290 | 1..111 | 100 | -> | Plus |
3L | 8332357..8332434 | 112..189 | 100 | -> | Plus |
Translation from 0 to 920
> LD46714.hyp RKGRVHINKKYINGQLTKGKNINKIMEKNKYVPRVNQIDAIYLNKDIARL IRDNLLENLQAISPVLFIKIQPELDLIIQSAIWFGSVGKRCSTFGQQLLV LAYDAEKLTVSRLVLHFILTVLPGYVKSWEERRLTRRVEWFSEAIMWVEN SALILNILNYFRFLKTGRKPTLVDYLLGLDYISLRNNQRRDIGYKYLTRE LLWGGFMEILGLVLPIINFRKLQRVLKSWTFSGRRLEDRDGPAFLAPQMT LSTTCTFCGERPTLPHHMGCGHIYCYYCLNANVLTDASFCCPNCGSACPE SGIQSV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Pex2-PA | 281 | CG7081-PA | 1..281 | 26..306 | 1490 | 100 | Plus |
Translation from 75 to 920
> LD46714.pep MEKNKYVPRVNQIDAIYLNKDIARLIRDNLLENLQAISPVLFIKIQPELD LIIQSAIWFGSVGKRCSTFGQQLLVLAYDAEKLTVSRLVLHFILTVLPGY VKSWEERRLTRRVEWFSEAIMWVENSALILNILNYFRFLKTGRKPTLVDY LLGLDYISLRNNQRRDIGYKYLTRELLWGGFMEILGLVLPIINFRKLQRV LKSWTFSGRRLEDRDGPAFLAPQMTLSTTCTFCGERPTLPHHMGCGHIYC YYCLNANVLTDASFCCPNCGSACPESGIQSV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10289-PA | 287 | GF10289-PA | 2..287 | 1..281 | 1305 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14303-PA | 285 | GG14303-PA | 1..285 | 1..281 | 1448 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15055-PA | 286 | GH15055-PA | 2..286 | 1..281 | 1238 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Pex2-PA | 281 | CG7081-PA | 1..281 | 1..281 | 1490 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12821-PA | 286 | GI12821-PA | 2..286 | 1..281 | 1223 | 78.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24695-PA | 285 | GL24695-PA | 2..285 | 1..281 | 1299 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20087-PA | 285 | GA20087-PA | 2..285 | 1..281 | 1299 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25045-PA | 285 | GM25045-PA | 1..285 | 1..281 | 1463 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14082-PA | 285 | GD14082-PA | 1..285 | 1..281 | 1463 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12964-PA | 286 | GJ12964-PA | 2..286 | 1..281 | 1259 | 81.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11933-PA | 282 | GK11933-PA | 2..282 | 1..281 | 1287 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20731-PA | 285 | GE20731-PA | 1..285 | 1..281 | 1439 | 94.4 | Plus |