Clone LD46744 Report

Search the DGRC for LD46744

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:467
Well:44
Vector:pOT2
Associated Gene/TranscriptTim10-RA
Protein status:LD46744.pep: gold
Preliminary Size:811
Sequenced Size:679

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9878 2001-01-01 Release 2 assignment
CG9878 2001-10-10 Blastp of sequenced clone
CG9878 2003-01-01 Sim4 clustering to Release 3
Tim10 2008-04-29 Release 5.5 accounting
Tim10 2008-08-15 Release 5.9 accounting
Tim10 2008-12-18 5.12 accounting

Clone Sequence Records

LD46744.complete Sequence

679 bp (679 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061513

> LD46744.complete
ATGTCGTTGGGCAACGCAGGGCGAATCGCTGTCTGTTGGACTGTTTTGAC
CGTGGGTGGCGTCTACGCATTTGTGCTGTCAAAGAGATCCGTTGAGAACC
GGCGTTACGAGAGCATGCGAGTGCGTGAGCGCATGAGGAAGGCAAACCAA
GGGGATTACGACTCAAGCGCAGCATCGGACAGGCGATTCGATTACTAAGC
GGCAGCATCCAGTACCTAAAACCCATCAGTAACACACCCACACCCACACA
ATGGCATTGCCCCAGATCAGCACCGCAGACCAGGCCAAGCTGCAGCTGAT
GCAGGAAATGGAGATCGAAATGATGTCCGATTTATATAACCGCATGACGA
ACGCTTGCCACAAAAAGTGCATTCCGCCGCGCTACTCCGAGTCGGAGTTG
GGCAAAGGCGAGATGGTGTGCATCGATCGCTGTGTGGCCAAATATCTGGA
CATTCACGAGAAGATCGGCAAGAAGCTGACGGCCATGTCCATGCAGGACG
AGGAGCTGATGAAGAAGATGTCTAGTTAACCTGGCACCCATTAACCCACA
TTTCCGCTTAACCAATGTGCATTTTTGAAGCGCTACGATTGTTAGAGGTA
CATGTACAAAACACCCCGTTGTAGAGAATAAACCACAGATTTATGTGTGC
TACATAATATCAAAAAAAAAAAAAAAAAA

LD46744.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-RA 690 Tim10-RA 30..690 1..661 3305 100 Plus
CG42497-RA 690 CG42497-RA 30..690 1..661 3305 100 Plus
Tim10-RB 687 Tim10-RB 64..687 38..661 3120 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17577122..17577486 402..38 1825 100 Minus
chr2R 21145070 chr2R 17576700..17576960 661..401 1290 99.6 Minus
chr2R 21145070 chr2R 17577556..17577594 39..1 180 97.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:43:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21690637..21691001 402..38 1825 100 Minus
2R 25286936 2R 21690214..21690475 662..401 1310 100 Minus
2R 25286936 2R 21691071..21691109 39..1 195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21691836..21692200 402..38 1825 100 Minus
2R 25260384 2R 21691413..21691674 662..401 1310 100 Minus
2R 25260384 2R 21692270..21692308 39..1 195 100 Minus
Blast to na_te.dros performed 2019-03-16 22:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 6386..6442 333..278 138 73.7 Minus

LD46744.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:10:47 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17576700..17576959 402..661 99 <- Minus
chr2R 17577123..17577485 39..401 100 <- Minus
chr2R 17577557..17577594 1..38 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:30:31 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RA 1..279 251..529 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:12 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RA 1..279 251..529 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:11:26 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RB 1..279 251..529 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:08 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RA 1..279 251..529 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:35:37 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RB 1..279 251..529 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:50 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RA 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:12 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RA 30..690 1..661 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:11:26 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 31..691 1..661 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:19:08 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RA 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:35:37 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 31..691 1..661 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:10:47 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21690215..21690474 402..661 100 <- Minus
2R 21690638..21691000 39..401 100 <- Minus
2R 21691072..21691109 1..38 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:10:47 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21690215..21690474 402..661 100 <- Minus
2R 21690638..21691000 39..401 100 <- Minus
2R 21691072..21691109 1..38 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:10:47 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21690215..21690474 402..661 100 <- Minus
2R 21690638..21691000 39..401 100 <- Minus
2R 21691072..21691109 1..38 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:11:26 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17577720..17577979 402..661 100 <- Minus
arm_2R 17578143..17578505 39..401 100 <- Minus
arm_2R 17578577..17578614 1..38 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:57 Download gff for LD46744.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21691414..21691673 402..661 100 <- Minus
2R 21691837..21692199 39..401 100 <- Minus
2R 21692271..21692308 1..38 100   Minus

LD46744.hyp Sequence

Translation from 250 to 528

> LD46744.hyp
MALPQISTADQAKLQLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESEL
GKGEMVCIDRCVAKYLDIHEKIGKKLTAMSMQDEELMKKMSS*

LD46744.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-PA 92 CG9878-PA 1..92 1..92 475 100 Plus
Tim10-PB 92 CG9878-PB 1..92 1..92 475 100 Plus

LD46744.pep Sequence

Translation from 250 to 528

> LD46744.pep
MALPQISTADQAKLQLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESEL
GKGEMVCIDRCVAKYLDIHEKIGKKLTAMSMQDEELMKKMSS*

LD46744.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11625-PA 92 GF11625-PA 1..92 1..92 474 98.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20751-PA 92 GG20751-PA 1..92 1..92 472 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22682-PA 92 GH22682-PA 1..92 1..92 457 94.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:52
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-PA 92 CG9878-PA 1..92 1..92 475 100 Plus
Tim10-PB 92 CG9878-PB 1..92 1..92 475 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20610-PA 93 GI20610-PA 3..93 2..92 459 95.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11269-PA 92 GL11269-PA 1..92 1..92 425 88 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22092-PA 92 GA22092-PA 1..92 1..92 425 88 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15694-PA 92 GM15694-PA 1..92 1..92 478 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25173-PA 92 GD25173-PA 1..92 1..92 478 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21050-PA 92 GJ21050-PA 1..92 1..92 462 95.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10647-PA 92 GK10647-PA 1..92 1..92 467 96.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13683-PA 92 GE13683-PA 1..92 1..92 472 97.8 Plus