Clone LD46766 Report

Search the DGRC for LD46766

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:467
Well:66
Vector:pOT2
Associated Gene/TranscriptCpr49Ae-RA
Protein status:LD46766.pep: gold
Preliminary Size:1295
Sequenced Size:1184

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8505 2003-01-01 Sim4 clustering to Release 3
CG8505 2003-02-27 Blastp of sequenced clone
Cpr49Ae 2008-04-29 Release 5.5 accounting
Cpr49Ae 2008-08-15 Release 5.9 accounting
Cpr49Ae 2008-12-18 5.12 accounting

Clone Sequence Records

LD46766.complete Sequence

1184 bp (1184 high quality bases) assembled on 2003-02-27

GenBank Submission: AY061515

> LD46766.complete
TTCAATTAACAACTGCAGTGTGCTGAGGACCCAGACGAAAGGATACACTT
GCCTTTTGGATTACACTACCGAATTTCTAACAAGATGAAGAACTTTGCTC
TCTGTCTGCTGGCCACCGCCTTGATGAGCTGCTGCCAGGCTGCCCCCCAA
AAGGCGGAGGAGCCCATCGCCATCATCAGCCAGGAGTCCAACATTGAGCC
AGATGGATCCTACAACTATGCCTATGAGACGGCCAATGGAATCAAAGCTG
AGGAGACCGGAACCCTGAAGAAGGCCACTTCGCCAGACTCCAGTGACGTG
ATCATCGCCAGGGGATCGGTGTCGTACACCTCGCCCGAGGGTAACCTGAT
CACACTGAACTACTCCGCCGATGATGAGAACGGTTTCCAGCCGCAGGGCG
ATCATCTGCCCACTCCGCCACCAATCCCGCCAGCGATCCAGAAGGCCCTT
GACTACCTGCTCAGCCTGCCACCGGCAAAGCGTCGTTAGGAGTGGATTAC
CCGCCAGATGTTGACCAACGATTCTGACCAACTTCGATTCTGATGTGTAG
ATGCTGCTCTGTTGCTGCAAGTTGATTGCTGCCCAACACCCCAATTCCGA
TCCCCAGACAATCACTCATAAGACACAAGCCAAGGGCTGTAACCTTCGCC
TCCTCCTACTTCTTTGCCCACTCAGGAGGTCAAAGGTCGGCCAAATCCAC
TGACTGAAGAACACACACACACACTCAAACGGATGTGAGGGACAACACGA
CACGAGAACCACATGACAACACCATGATACTGATAGCCCAGTCTGATTTC
TTGCTTTCTTCCAACGAACTCTACTACTCTATGCGAATCTCTTCAGATCT
TTTAGTCGCCGGAACTCTGCCATTTTCGGACTCATGTGATATCGTCGATT
TATCAATGAAATCAACAAGGAAAATGTAAAAAAAAAAAATACACGCAAAC
AAGAAATTAACTAAATAATATACAGGAATATTATCAACAGCGAACTTTGT
GTAAATAGTCTGTAAATTAGAAACATTTACACGTAGTCTTAGCCAAGATG
TCGATGAGGATTCCTCGTTGCGTCGAGAATTATACAAACTCTTGTGAAGA
ACTATGATGATATTCTTTAGCCTTTAGCTGCAAATAAAGAATTAAAGATT
CTTTCGAAAAGTAAAAAAAAAAAAAAAAAAAAAA

LD46766.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:16:38
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Ae-RA 1342 Cpr49Ae-RA 172..1342 1..1169 5785 99.7 Plus
Cpr49Ae.a 1876 Cpr49Ae.a 172..1342 1..1169 5785 99.7 Plus
Cpr49Aa-RB 695 Cpr49Aa-RB 416..486 376..446 235 88.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8291392..8292349 222..1162 4355 97.7 Plus
chr2R 21145070 chr2R 8290608..8290735 94..221 625 99.2 Plus
chr2R 21145070 chr2R 8289466..8289558 1..93 465 100 Plus
chr2R 21145070 chr2R 8264427..8264497 376..446 235 88.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:43:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12404166..12405115 222..1169 4670 99.7 Plus
2R 25286936 2R 12403381..12403508 94..221 640 100 Plus
2R 25286936 2R 12402238..12402330 1..93 465 100 Plus
2R 25286936 2R 12377158..12377228 376..446 235 88.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12405365..12406314 222..1169 4680 99.6 Plus
2R 25260384 2R 12404580..12404707 94..221 640 100 Plus
2R 25260384 2R 12403437..12403529 1..93 465 100 Plus
2R 25260384 2R 12378357..12378427 376..446 235 88.7 Plus
Blast to na_te.dros performed 2019-03-16 20:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
rover 7318 rover ROVER 7318bp 6373..6445 917..990 123 68 Plus
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 2..57 933..989 111 68.4 Plus

LD46766.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:16:30 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8289466..8289558 1..93 100 -> Plus
chr2R 8290608..8290735 94..221 99 -> Plus
chr2R 8291392..8292349 222..1162 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:30:36 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ae-RA 1..405 85..489 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:47:03 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ae-RA 1..405 85..489 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:05 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ae-RA 1..405 85..489 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:38:31 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ae-RA 1..405 85..489 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:55:49 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ae-RA 1..405 85..489 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:58:50 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ae-RA 24..1187 1..1162 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:47:03 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ae-RA 24..1187 1..1162 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:05 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ae-RA 23..1186 1..1162 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:38:31 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ae-RA 24..1187 1..1162 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:55:49 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Ae-RA 23..1186 1..1162 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:30 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12403381..12403508 94..221 100 -> Plus
2R 12402238..12402330 1..93 100 -> Plus
2R 12404166..12405108 222..1162 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:30 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12403381..12403508 94..221 100 -> Plus
2R 12402238..12402330 1..93 100 -> Plus
2R 12404166..12405108 222..1162 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:30 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12403381..12403508 94..221 100 -> Plus
2R 12402238..12402330 1..93 100 -> Plus
2R 12404166..12405108 222..1162 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:05 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8289743..8289835 1..93 100 -> Plus
arm_2R 8290886..8291013 94..221 100 -> Plus
arm_2R 8291671..8292613 222..1162 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:08:46 Download gff for LD46766.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12405365..12406307 222..1162 99   Plus
2R 12403437..12403529 1..93 100 -> Plus
2R 12404580..12404707 94..221 100 -> Plus

LD46766.pep Sequence

Translation from 84 to 488

> LD46766.pep
MKNFALCLLATALMSCCQAAPQKAEEPIAIISQESNIEPDGSYNYAYETA
NGIKAEETGTLKKATSPDSSDVIIARGSVSYTSPEGNLITLNYSADDENG
FQPQGDHLPTPPPIPPAIQKALDYLLSLPPAKRR*

LD46766.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12857-PA 134 GF12857-PA 1..134 1..134 628 95.5 Plus
Dana\GF12852-PA 141 GF12852-PA 1..125 1..130 276 56.9 Plus
Dana\GF10274-PA 119 GF10274-PA 26..119 29..132 241 49.1 Plus
Dana\GF23528-PA 253 GF23528-PA 128..223 28..125 234 64.3 Plus
Dana\GF10617-PA 121 GF10617-PA 6..114 7..129 225 41.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:42:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20293-PA 134 GG20293-PA 1..134 1..134 691 99.3 Plus
Dere\GG20286-PA 326 GG20286-PA 151..273 4..125 280 58.7 Plus
Dere\GG13245-PA 121 GG13245-PA 1..115 1..131 238 41.2 Plus
Dere\GG14999-PA 178 GG14999-PA 6..116 5..124 233 45.1 Plus
Dere\GG22686-PA 135 GG22686-PA 9..124 5..114 230 44.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20698-PA 136 GH20698-PA 1..135 1..134 517 80 Plus
Dgri\GH20692-PA 142 GH20692-PA 3..127 4..130 265 53.9 Plus
Dgri\GH20700-PA 134 GH20700-PA 1..133 1..112 233 42.5 Plus
Dgri\GH15299-PA 118 GH15299-PA 1..110 1..124 225 40.8 Plus
Dgri\GH16160-PA 120 GH16160-PA 1..117 1..133 223 36.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Ae-PA 134 CG8505-PA 1..134 1..134 696 100 Plus
Cpr49Aa-PB 144 CG30045-PB 3..130 4..130 347 58 Plus
Cpr65Az-PA 239 CG12330-PA 112..209 26..125 296 64 Plus
Cpr67Fa1-PA 134 CG7941-PA 2..117 4..129 251 44.1 Plus
Cpr78Cc-PA 119 CG7658-PA 1..117 1..130 250 44.7 Plus
Cpr67Fa2-PA 134 CG18349-PA 2..117 4..129 250 44.1 Plus
Cpr47Ef-PD 601 CG13214-PD 126..225 20..122 250 50.5 Plus
Cpr47Ef-PC 612 CG13214-PC 126..225 20..122 250 50.5 Plus
Edg78E-PB 122 CG7673-PB 1..115 1..131 240 40.5 Plus
Edg78E-PA 122 CG7673-PA 1..115 1..131 240 40.5 Plus
Cpr47Ea-PA 135 CG9079-PA 9..127 5..117 234 42.6 Plus
Cpr49Ah-PA 190 CG8515-PA 51..146 28..125 224 50.5 Plus
Cpr67Fb-PA 122 CG18348-PA 14..114 19..129 223 47.3 Plus
Cpr65Ec-PA 127 CG8634-PA 1..121 1..134 223 38.8 Plus
Cpr65Eb-PA 179 CG8638-PA 9..116 8..124 221 45.4 Plus
Cpr49Ag-PA 134 CG8511-PA 40..133 30..112 215 49.5 Plus
Cpr49Af-PB 126 CG8510-PB 23..114 31..125 210 43.2 Plus
Cpr49Af-PA 126 CG8510-PA 23..114 31..125 210 43.2 Plus
Cpr49Ab-PA 259 CG30042-PA 160..251 29..125 209 46.4 Plus
Cpr65Av-PA 111 CG32405-PA 1..109 1..109 203 42.5 Plus
Lcp65Ac-PA 109 CG6956-PA 5..106 6..112 194 42.1 Plus
Lcp65Ad-PB 108 CG6955-PB 3..106 4..111 185 35.2 Plus
Lcp65Ad-PA 108 CG6955-PA 3..106 4..111 185 35.2 Plus
Cpr65Ea-PA 127 CG8640-PA 5..112 8..129 180 39.3 Plus
Cpr11B-PB 195 CG2555-PB 63..155 22..117 178 39.2 Plus
Cpr11B-PA 197 CG2555-PA 63..155 22..117 178 39.2 Plus
Cpr65Ax2-PB 102 CG18777-PB 3..100 4..112 173 41.3 Plus
Cpr65Ax2-PA 102 CG18777-PA 3..100 4..112 173 41.3 Plus
Cpr65Ax1-PA 102 CG34270-PA 3..100 4..112 173 41.3 Plus
Cpr47Eg-PA 117 CG9070-PA 9..117 7..132 171 35.2 Plus
Pcp-PA 184 CG3440-PA 6..117 3..129 171 33.1 Plus
Cpr65Aw-PA 117 CG32404-PA 7..104 8..109 166 38.2 Plus
Lcp1-PB 130 CG11650-PB 34..123 30..131 163 39.2 Plus
Lcp1-PA 130 CG11650-PA 34..123 30..131 163 39.2 Plus
Lcp2-PB 126 CG8697-PB 1..119 1..131 162 32.1 Plus
Lcp2-PA 126 CG8697-PA 1..119 1..131 162 32.1 Plus
Lcp65Af-PA 100 CG10533-PA 18..100 28..114 161 37.9 Plus
Cpr47Ee-PA 369 CG13222-PA 105..188 28..112 161 37.6 Plus
Acp65Aa-PA 105 CG10297-PA 14..104 13..109 155 36.1 Plus
Lcp3-PB 112 CG2043-PB 5..109 13..129 151 34.2 Plus
Lcp3-PA 112 CG2043-PA 5..109 13..129 151 34.2 Plus
Cpr100A-PA 241 CG12045-PA 27..103 29..116 150 40.9 Plus
Lcp65Aa-PA 102 CG7287-PA 3..100 5..109 149 36.2 Plus
Lcp65Ag3-PA 105 CG18779-PA 5..103 8..112 149 37.1 Plus
Lcp4-PB 112 CG2044-PB 5..109 13..129 148 35 Plus
Lcp4-PA 112 CG2044-PA 5..109 13..129 148 35 Plus
Cpr78Cb-PB 140 CG7663-PB 47..125 35..125 144 38.5 Plus
Cpr78Cb-PA 140 CG7663-PA 47..125 35..125 144 38.5 Plus
Cpr65Aw-PB 86 CG32404-PB 14..73 47..109 140 49.2 Plus
Cpr78Ca-PA 127 CG11310-PA 11..118 6..130 140 30.4 Plus
Lcp65Ab1-PA 104 CG32400-PA 5..102 8..112 135 34.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19058-PA 136 GI19058-PA 1..135 1..134 493 84.4 Plus
Dmoj\GI19053-PA 141 GI19053-PA 3..127 4..130 268 54.7 Plus
Dmoj\GI12994-PA 134 GI12994-PA 2..113 4..129 255 47.6 Plus
Dmoj\GI12010-PA 117 GI12010-PA 1..116 1..130 245 40.5 Plus
Dmoj\GI13312-PA 120 GI13312-PA 1..117 1..133 239 39.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11634-PA 134 GL11634-PA 1..134 1..134 614 94.8 Plus
Dper\GL11629-PA 149 GL11629-PA 12..134 6..130 293 59.5 Plus
Dper\GL24679-PA 120 GL24679-PA 1..120 1..133 251 43.3 Plus
Dper\GL24678-PA 119 GL24678-PA 1..116 1..129 232 41.5 Plus
Dper\GL11748-PA 122 GL11748-PA 2..114 4..129 226 43.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21125-PA 121 GA21125-PA 1..121 14..134 549 95.9 Plus
Dpse\GA15602-PA 149 GA15602-PA 10..134 4..130 288 57.8 Plus
Dpse\GA20507-PA 120 GA20507-PA 1..120 1..133 250 43.3 Plus
Dpse\GA11560-PA 248 GA11560-PA 125..222 26..125 239 63 Plus
Dpse\GA23947-PA 119 GA23947-PA 1..116 1..129 232 41.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21380-PA 134 GM21380-PA 1..134 1..134 697 100 Plus
Dsec\GM21373-PA 294 GM21373-PA 171..275 18..125 258 63 Plus
Dsec\GM22355-PA 120 GM22355-PA 26..118 29..131 253 52.8 Plus
Dsec\GM22150-PA 122 GM22150-PA 1..115 1..131 237 41.2 Plus
Dsec\GM14766-PA 239 GM14766-PA 112..209 26..125 232 64 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10877-PA 134 GD10877-PA 1..134 1..134 697 100 Plus
Dsim\GD10870-PA 267 GD10870-PA 144..248 18..125 258 63 Plus
Dsim\GD14949-PA 120 GD14949-PA 26..118 29..131 247 50.9 Plus
Dsim\GD12126-PA 122 GD12126-PA 1..115 1..131 237 41.2 Plus
Dsim\GD14266-PA 116 GD14266-PA 6..113 8..125 235 43.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20027-PA 136 GJ20027-PA 1..135 1..134 481 82.2 Plus
Dvir\GJ12743-PA 255 GJ12743-PA 129..226 26..125 287 62 Plus
Dvir\GJ13137-PA 139 GJ13137-PA 2..114 4..129 273 47.6 Plus
Dvir\GJ20022-PA 173 GJ20022-PA 37..159 6..130 264 56.3 Plus
Dvir\GJ12082-PA 120 GJ12082-PA 1..117 1..133 237 41.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22931-PA 134 GK22931-PA 1..134 1..134 590 89.6 Plus
Dwil\GK22933-PA 133 GK22933-PA 5..132 6..112 249 43.4 Plus
Dwil\GK17540-PA 191 GK17540-PA 44..122 40..129 230 53.3 Plus
Dwil\GK20466-PA 121 GK20466-PA 3..117 4..129 225 42.2 Plus
Dwil\GK16649-PA 134 GK16649-PA 18..127 14..134 222 42.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12453-PA 134 GE12453-PA 1..134 1..134 694 99.3 Plus
Dyak\GE12447-PA 210 GE12447-PA 54..158 18..125 257 63 Plus
Dyak\GE22345-PA 121 GE22345-PA 1..115 1..131 235 42 Plus
Dyak\GE22714-PA 120 GE22714-PA 4..114 8..131 231 42.7 Plus
Dyak\GE23051-PA 119 GE23051-PA 1..117 1..130 230 47 Plus

LD46766.hyp Sequence

Translation from 84 to 488

> LD46766.hyp
MKNFALCLLATALMSCCQAAPQKAEEPIAIISQESNIEPDGSYNYAYETA
NGIKAEETGTLKKATSPDSSDVIIARGSVSYTSPEGNLITLNYSADDENG
FQPQGDHLPTPPPIPPAIQKALDYLLSLPPAKRR*

LD46766.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Ae-PA 134 CG8505-PA 1..134 1..134 696 100 Plus
Cpr49Aa-PB 144 CG30045-PB 3..130 4..130 347 58 Plus
Cpr65Az-PA 239 CG12330-PA 112..209 26..125 296 64 Plus
Cpr67Fa1-PA 134 CG7941-PA 2..117 4..129 251 44.1 Plus
Cpr78Cc-PA 119 CG7658-PA 1..117 1..130 250 44.7 Plus