Clone LD47054 Report

Search the DGRC for LD47054

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:470
Well:54
Vector:pOT2
Associated Gene/TranscriptArp6-RA
Protein status:LD47054.pep: gold
Preliminary Size:1471
Sequenced Size:1321

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11678 2001-09-19 Blastp of sequenced clone
CG11678 2003-01-01 Sim4 clustering to Release 3
Actr13E 2008-04-29 Release 5.5 accounting
Actr13E 2008-08-15 Release 5.9 accounting
Actr13E 2008-12-18 5.12 accounting

Clone Sequence Records

LD47054.complete Sequence

1321 bp (1321 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058726

> LD47054.complete
CTCTTCCGAAAAATGGTATAGATCTACGTTGAGGACGAAAAGGATGGCCA
ACGCTGTGGTGGTGTTGGACAACGGAGCGCATACGGCGAAAGTGGGCCTG
GCCAATCAGGATGAGCCCCATGTGGTGCCCAACTGCATCATGAAAGCAAA
GAGCGAGCGGCGACGCGCTTTTGTGGGAAATCAGATAGATGAATGCCGGG
ACACATCGGCGCTCTATTACATTCTGGCGTTCCAGCGCGGCTACCTGCTC
AACTGGCACACACAGAAAACGGTGTGGGATTACATATTCAGCAAGGACGG
CATTGGTTGTTCGCTGGAGAACCGCAATATTGTCATCACTGAGCCGCAGA
TGAACTTCCAGAGCATCCAGGAGGCAACGCTGGAGATTCTGTTTGAGGAG
TACAAGGTTGATGGGGTGTACAAGACCACTGCTGCCGATCTGGCTGCCTT
TAACTATGTGGCTGACAGCGAGGAGCGGACTACAATGGAATCGCTTAACT
GCATCATCATCGATGTAGGCTACAGTTTCACCCACGTTGTTCCTTTTGTG
CTGGGACGGCGCGTTCTCCAAGGCATACGACGCATCGACATGGGCGGGAA
GGCGCTGACCAACCAGCTAAAGGAGCTAATCTCTTATCGCCACCTAAACG
TCATGGACGAGAGTCATGTAGTTAACCAGATCAAGGAAGATGTCTGCTTT
GTGGCGGAGGACTTCAAGCAGGCGATGCAGGTGCATTATTCGGAGGAGAA
GCGACGCGAAGTCACAGTTGATTATGTCCTTCCAGACTTCACCACCGTCA
AACGGGGCTATGTTCGTGTTCCCGGAAAGCCGCGCGAGGATGAGGAGCAA
CAGCAAATGGTGTCGCTGTGCAATGAACGTTTCACCGTGCCCGAGCTGCT
CTTCAATCCCTCGGACATTGGTGTGCAACAGGTGGGCATTCCGGAAGCGG
TGGCCGATTGTCTGAAGGCTTGCCCCTGGGAAGCGCACCGCGAACTCCTG
CTCAACATCCTTATTGTGGGCGGCAGTGCCCAGTTTCCGGGATTTCTGCC
GCGCCTAAAGCGCGATTTACGTGCCCTGGTGCCCGACGATCTTGAAGTGT
CACTCATCTGTCCCGAGGATCCGGTGCGGTACGCGTGGTACGGCGGCAAG
GAGGTTGCGACCAGCCCCAACTTTGAAGAGTTTGTTTACACGCAAGACGA
CTACGAGGAGTACGGTTTCCAGGGTATCAATCAGCGGTAACATGCACGTA
GTCGAAGTATTTTTTCAATAATAAACTTGATTTGCACATGGGTTTTCTAG
AACAAAAAAAAAAAAAAAAAA

LD47054.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
Actr13E-RA 1304 Actr13E-RA 1..1304 1..1304 6520 100 Plus
Actr13E.a 1350 Actr13E.a 99..828 1..730 3650 100 Plus
Actr13E.a 1350 Actr13E.a 826..1347 783..1304 2610 100 Plus
l(1)G0136-RA 924 l(1)G0136-RA 869..924 1304..1249 280 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15625610..15626912 1303..1 6485 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:43:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15735773..15737076 1304..1 6520 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15743871..15745174 1304..1 6520 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:10:40 has no hits.

LD47054.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:11:41 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15625610..15626912 1..1303 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:30:55 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
Actr13E-RA 1..1197 44..1240 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:58:50 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
Actr13E-RA 1..1197 44..1240 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:10:24 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
Arp6-RA 1..1197 44..1240 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:29:10 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
Actr13E-RA 1..1197 44..1240 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:32:10 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
Arp6-RA 1..1197 44..1240 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:45:46 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
Actr13E-RA 1..1303 1..1303 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:58:50 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
Actr13E-RA 1..1303 1..1303 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:10:24 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
Arp6-RA 45..1347 1..1303 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:29:10 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
Actr13E-RA 1..1303 1..1303 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:32:10 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
Arp6-RA 45..1347 1..1303 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:11:41 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
X 15735774..15737076 1..1303 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:11:41 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
X 15735774..15737076 1..1303 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:11:41 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
X 15735774..15737076 1..1303 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:10:24 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15629807..15631109 1..1303 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:05:30 Download gff for LD47054.complete
Subject Subject Range Query Range Percent Splice Strand
X 15743872..15745174 1..1303 100   Minus

LD47054.hyp Sequence

Translation from 0 to 1239

> LD47054.hyp
SSEKWYRSTLRTKRMANAVVVLDNGAHTAKVGLANQDEPHVVPNCIMKAK
SERRRAFVGNQIDECRDTSALYYILAFQRGYLLNWHTQKTVWDYIFSKDG
IGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGVYKTTAADLAAF
NYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGK
ALTNQLKELISYRHLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEK
RREVTVDYVLPDFTTVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELL
FNPSDIGVQQVGIPEAVADCLKACPWEAHRELLLNILIVGGSAQFPGFLP
RLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYTQDD
YEEYGFQGINQR*

LD47054.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
Arp6-PA 398 CG11678-PA 1..398 15..412 2091 100 Plus
Act87E-PC 376 CG18290-PC 7..367 18..405 421 26.4 Plus
Act87E-PB 376 CG18290-PB 7..367 18..405 421 26.4 Plus
Act87E-PA 376 CG18290-PA 7..367 18..405 421 26.4 Plus
Act57B-PA 376 CG10067-PA 7..367 18..405 418 26.1 Plus

LD47054.pep Sequence

Translation from 43 to 1239

> LD47054.pep
MANAVVVLDNGAHTAKVGLANQDEPHVVPNCIMKAKSERRRAFVGNQIDE
CRDTSALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITE
PQMNFQSIQEATLEILFEEYKVDGVYKTTAADLAAFNYVADSEERTTMES
LNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLKELISYRH
LNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFT
TVKRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIP
EAVADCLKACPWEAHRELLLNILIVGGSAQFPGFLPRLKRDLRALVPDDL
EVSLICPEDPVRYAWYGGKEVATSPNFEEFVYTQDDYEEYGFQGINQR*

LD47054.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22239-PA 398 GF22239-PA 1..398 1..398 1985 90.5 Plus
Dana\GF17602-PA 376 GF17602-PA 7..373 4..398 434 26.7 Plus
Dana\GF12208-PA 376 GF12208-PA 7..373 4..398 432 26.4 Plus
Dana\GF13827-PA 376 GF13827-PA 7..367 4..391 426 25.9 Plus
Dana\GF18300-PA 376 GF18300-PA 7..373 4..398 424 26.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19378-PA 398 GG19378-PA 1..398 1..398 2051 94.5 Plus
Dere\GG19688-PA 376 GG19688-PA 7..373 4..398 434 26.7 Plus
Dere\GG22068-PA 376 GG22068-PA 7..373 4..398 432 26.4 Plus
Dere\GG18797-PA 376 GG18797-PA 7..367 4..391 429 26.1 Plus
Dere\GG10840-PA 376 GG10840-PA 7..367 4..391 427 25.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24434-PA 396 GH24434-PA 2..396 4..398 1896 87.1 Plus
Dgri\GH19045-PA 376 GH19045-PA 7..373 4..398 434 26.7 Plus
Dgri\GH22007-PA 376 GH22007-PA 7..373 4..398 432 26.4 Plus
Dgri\GH24372-PA 376 GH24372-PA 7..367 4..391 429 26.1 Plus
Dgri\GH20408-PA 376 GH20408-PA 7..367 4..391 428 25.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
Arp6-PA 398 CG11678-PA 1..398 1..398 2091 100 Plus
Act87E-PC 376 CG18290-PC 7..367 4..391 421 26.4 Plus
Act87E-PB 376 CG18290-PB 7..367 4..391 421 26.4 Plus
Act87E-PA 376 CG18290-PA 7..367 4..391 421 26.4 Plus
Act57B-PA 376 CG10067-PA 7..367 4..391 418 26.1 Plus
Act5C-PE 376 CG4027-PE 7..367 4..391 416 26.1 Plus
Act5C-PD 376 CG4027-PD 7..367 4..391 416 26.1 Plus
Act5C-PC 376 CG4027-PC 7..367 4..391 416 26.1 Plus
Act5C-PA 376 CG4027-PA 7..367 4..391 416 26.1 Plus
Act5C-PB 376 CG4027-PB 7..367 4..391 416 26.1 Plus
Act42A-PA 376 CG12051-PA 7..367 4..391 414 25.9 Plus
Act79B-PB 376 CG7478-PB 7..367 4..391 412 26.1 Plus
Act79B-PA 376 CG7478-PA 7..367 4..391 412 26.1 Plus
Act88F-PA 376 CG5178-PA 9..367 6..391 411 26 Plus
Arp1-PA 376 CG6174-PA 7..374 1..398 360 26 Plus
Arp53D-PB 411 CG5409-PB 46..402 3..391 324 25.6 Plus
Arp2-PB 394 CG9901-PB 8..384 5..393 312 26 Plus
Arp2-PA 394 CG9901-PA 8..384 5..393 312 26 Plus
Arp3-PB 418 CG7558-PB 9..404 7..391 305 26.3 Plus
Arp3-PA 418 CG7558-PA 9..404 7..391 305 26.3 Plus
Arp2-PC 399 CG9901-PC 8..389 5..393 300 25.4 Plus
Arp5-PB 648 CG7940-PB 6..266 5..244 223 26.1 Plus
Arp5-PA 648 CG7940-PA 6..266 5..244 223 26.1 Plus
Arp5-PB 648 CG7940-PB 484..629 243..391 179 30.9 Plus
Arp5-PA 648 CG7940-PA 484..629 243..391 179 30.9 Plus
Arp10-PB 378 CG12235-PB 14..309 6..349 176 22.4 Plus
Arp10-PA 378 CG12235-PA 14..309 6..349 176 22.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16293-PA 399 GI16293-PA 5..399 4..398 1900 86.6 Plus
Dmoj\GI24339-PA 376 GI24339-PA 7..373 4..398 434 26.7 Plus
Dmoj\GI19711-PA 376 GI19711-PA 7..373 4..398 432 26.4 Plus
Dmoj\GI19595-PA 376 GI19595-PA 7..367 4..391 430 26.1 Plus
Dmoj\GI15312-PA 376 GI15312-PA 7..367 4..391 429 26.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16521-PA 398 GL16521-PA 1..398 1..398 1921 86.9 Plus
Dper\GL17061-PA 376 GL17061-PA 7..373 4..398 432 26.4 Plus
Dper\GL14888-PA 376 GL14888-PA 7..367 4..391 429 26.1 Plus
Dper\GL17787-PA 376 GL17787-PA 7..367 4..391 428 25.9 Plus
Dper\GL26327-PA 376 GL26327-PA 9..367 6..391 417 25.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11138-PA 398 GA11138-PA 1..398 1..398 1921 86.9 Plus
Dpse\GA14877-PB 376 GA14877-PB 7..373 4..398 434 26.7 Plus
Dpse\GA14877-PA 376 GA14877-PA 7..373 4..398 434 26.7 Plus
Dpse\GA24346-PA 376 GA24346-PA 7..373 4..398 432 26.4 Plus
Dpse\GA17886-PA 376 GA17886-PA 7..367 4..391 429 26.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22532-PA 278 GM22532-PA 1..278 103..398 1307 85.1 Plus
Dsec\GM22534-PA 183 GM22534-PA 4..183 219..398 942 96.1 Plus
Dsec\GM24109-PA 376 GM24109-PA 7..373 4..398 429 26.7 Plus
Dsec\GM12447-PA 376 GM12447-PA 7..367 4..391 429 26.1 Plus
Dsec\GM16492-PA 376 GM16492-PA 7..367 4..391 427 25.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15782-PA 398 GD15782-PA 1..398 1..398 2090 96.5 Plus
Dsim\GD18909-PA 376 GD18909-PA 7..373 4..398 434 26.7 Plus
Dsim\GD11548-PA 376 GD11548-PA 7..373 4..398 432 26.4 Plus
Dsim\GD16764-PA 376 GD16764-PA 7..367 4..391 429 26.1 Plus
Dsim\GD10342-PA 376 GD10342-PA 7..367 4..391 427 25.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16533-PA 396 GJ16533-PA 2..396 4..398 1921 87.3 Plus
Dvir\ActE1-PA 376 GJ10425-PA 7..373 4..398 434 26.7 Plus
Dvir\ActC2-PA 376 GJ17479-PA 7..373 4..398 432 26.4 Plus
Dvir\GJ18395-PA 376 GJ18395-PA 7..367 4..391 430 26.1 Plus
Dvir\GJ14747-PA 376 GJ14747-PA 7..367 4..391 429 26.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10108-PA 398 GK10108-PA 1..398 1..398 1913 85.9 Plus
Dwil\GK13943-PA 376 GK13943-PA 7..373 4..398 434 26.7 Plus
Dwil\GK23336-PA 376 GK23336-PA 7..373 4..398 432 26.4 Plus
Dwil\GK20124-PA 376 GK20124-PA 7..367 4..391 429 26.1 Plus
Dwil\GK21751-PA 376 GK21751-PA 7..367 4..391 427 25.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16026-PA 398 GE16026-PA 1..398 1..398 2065 95.2 Plus
Dyak\GE26273-PA 376 GE26273-PA 7..373 4..398 434 26.7 Plus
Dyak\GE12149-PA 376 GE12149-PA 7..373 4..398 432 26.4 Plus
Dyak\Act57B-PA 376 GE17558-PA 7..367 4..391 429 26.1 Plus
Dyak\GE19434-PA 376 GE19434-PA 7..367 4..391 426 25.9 Plus