Clone LD47064 Report

Search the DGRC for LD47064

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:470
Well:64
Vector:pOT2
Associated Gene/TranscriptRpLP0-like-RA
Protein status:LD47064.pep: gold
Preliminary Size:1043
Sequenced Size:932

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1381 2001-10-10 Blastp of sequenced clone
CG1381 2003-01-01 Sim4 clustering to Release 3
CG1381 2008-04-29 Release 5.5 accounting
CG1381 2008-08-15 Release 5.9 accounting
CG1381 2008-12-18 5.12 accounting

Clone Sequence Records

LD47064.complete Sequence

932 bp (932 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061517

> LD47064.complete
TTCGGTGGGAAATATTCTTGGTTTCTGTTAAGAAAACGTTGCTATTTAAA
GGCTACAGATATGCCGCGCTCCAAACGTGATAAGAAAGTTTCCCTGACCA
AAACCGACCGCAAGGGTCTGGCTTGGAAACAGCGCATTGTGGACGACATT
CGGTTCTGCGTGGGCAAATACCCAAATATATTCGTTTTCCAAGTTCAGAA
CATGAGGAATAGCTTGCTGAAGGATCTGCGACAGGAGTTGAAAAAGAATT
CTCGTTTTATCTTTGGCAAGAATCGTGTTATGCAGATTGGCTTGGGTCGC
ACGAAGAGCGAGGAAGTGGAGCCGGAATTGCACAAGCTATCCAAGCGATT
AACTGGCCAGGTGGGACTGCTTTTCACGGACAAATCCAAGGAGGAAGTCC
TGGAGTGGGCAGAAAACTACTGGGCCGTGGAATACGCACGCAGTGGCTTT
GTGGCCACGGAAACGGTTACCCTGCCAGCAGGTCCCCTAGAGGACTTCGC
CCACTCTATGGAACCGCATCTGCGTTCCCTGGGCCTGCCCACCAAATTGG
AGAAGGGAATCGTTACGCTGTACAGTGACTACACGGTTTGTGAGGAGGGC
AAAGTTCTAACACCCGAACAGGCGAGAATCCTCAAGCTGGTGGGCAAGCC
CATGGCCAAATTTCGGCTGACCATGAAGTGCTCGTGGACAAAAAGCGAAG
GCTTCCAGCTGCATGTCGAGGATGATGTGAACGACGAGGAACAGGCTGAT
AGCGCAATGGAAGAGGAGGCCGAGGCCGAGGCCATGGATGACAACGACGA
CGATGATGACGAAGAGGAGGATGATGAATAAATAAGTTTAAGGCGTAGAA
ATAATTTTTTTATGTATATATCAAGTGCAGAAAATATACGTATATTTTAA
AAGTAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD47064.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG1381-RA 1032 CG1381-RA 129..1032 1..904 4520 100 Plus
Jra-RA 1543 Jra-RA 1504..1543 905..866 200 100 Minus
Jra-RB 1565 Jra-RB 1526..1565 905..866 200 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5986073..5986642 904..335 2850 100 Minus
chr2R 21145070 chr2R 5986701..5986950 336..87 1250 100 Minus
chr2R 21145070 chr2R 5987014..5987101 88..1 440 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:43:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10098517..10099087 905..335 2855 100 Minus
2R 25286936 2R 10099146..10099395 336..87 1250 100 Minus
2R 25286936 2R 10099459..10099546 88..1 440 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10099716..10100286 905..335 2855 100 Minus
2R 25260384 2R 10100345..10100594 336..87 1250 100 Minus
2R 25260384 2R 10100658..10100745 88..1 440 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:43:23 has no hits.

LD47064.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:44:11 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5986073..5986640 337..904 100 <- Minus
chr2R 5986701..5986948 89..336 100 <- Minus
chr2R 5987014..5987101 1..88 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:30:56 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
CG1381-RA 1..771 61..831 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:40:32 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-like-RA 1..771 61..831 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:31 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-like-RA 1..771 61..831 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:18:38 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
CG1381-RA 1..771 61..831 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:52:35 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-like-RA 1..771 61..831 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:46:04 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
CG1381-RA 41..944 1..904 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:40:31 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-like-RA 41..944 1..904 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:31 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-like-RA 45..948 1..904 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:18:38 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
CG1381-RA 41..944 1..904 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:52:35 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-like-RA 45..948 1..904 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:44:11 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10099459..10099546 1..88 100   Minus
2R 10098518..10099085 337..904 100 <- Minus
2R 10099146..10099393 89..336 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:44:11 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10099459..10099546 1..88 100   Minus
2R 10098518..10099085 337..904 100 <- Minus
2R 10099146..10099393 89..336 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:44:11 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10099459..10099546 1..88 100   Minus
2R 10098518..10099085 337..904 100 <- Minus
2R 10099146..10099393 89..336 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:31 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5986023..5986590 337..904 100 <- Minus
arm_2R 5986651..5986898 89..336 100 <- Minus
arm_2R 5986964..5987051 1..88 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:53:35 Download gff for LD47064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10099717..10100284 337..904 100 <- Minus
2R 10100345..10100592 89..336 100 <- Minus
2R 10100658..10100745 1..88 100   Minus

LD47064.hyp Sequence

Translation from 0 to 830

> LD47064.hyp
FGGKYSWFLLRKRCYLKATDMPRSKRDKKVSLTKTDRKGLAWKQRIVDDI
RFCVGKYPNIFVFQVQNMRNSLLKDLRQELKKNSRFIFGKNRVMQIGLGR
TKSEEVEPELHKLSKRLTGQVGLLFTDKSKEEVLEWAENYWAVEYARSGF
VATETVTLPAGPLEDFAHSMEPHLRSLGLPTKLEKGIVTLYSDYTVCEEG
KVLTPEQARILKLVGKPMAKFRLTMKCSWTKSEGFQLHVEDDVNDEEQAD
SAMEEEAEAEAMDDNDDDDDEEEDDE*

LD47064.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP0-like-PA 256 CG1381-PA 1..256 21..276 1331 100 Plus

LD47064.pep Sequence

Translation from 60 to 830

> LD47064.pep
MPRSKRDKKVSLTKTDRKGLAWKQRIVDDIRFCVGKYPNIFVFQVQNMRN
SLLKDLRQELKKNSRFIFGKNRVMQIGLGRTKSEEVEPELHKLSKRLTGQ
VGLLFTDKSKEEVLEWAENYWAVEYARSGFVATETVTLPAGPLEDFAHSM
EPHLRSLGLPTKLEKGIVTLYSDYTVCEEGKVLTPEQARILKLVGKPMAK
FRLTMKCSWTKSEGFQLHVEDDVNDEEQADSAMEEEAEAEAMDDNDDDDD
EEEDDE*

LD47064.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12908-PA 258 GF12908-PA 1..241 1..242 1199 92.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25231-PA 255 GG25231-PA 1..255 1..255 1335 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20636-PA 247 GH20636-PA 1..219 1..219 1081 89.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP0-like-PA 256 CG1381-PA 1..256 1..256 1331 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18999-PA 259 GI18999-PA 1..222 1..222 1099 90.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16862-PA 251 GL16862-PA 1..233 1..233 1152 90.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12545-PA 252 GA12545-PA 1..233 1..233 1152 90.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20550-PA 252 GM20550-PA 1..252 1..252 1321 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15262-PA 256 GD15262-PA 1..256 1..256 1352 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19965-PA 259 GJ19965-PA 1..233 1..233 1134 88.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21826-PA 250 GK21826-PA 1..232 1..233 1121 88.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21775-PA 254 GE21775-PA 1..254 1..256 1316 97.7 Plus