Clone LD47143 Report

Search the DGRC for LD47143

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:471
Well:43
Vector:pOT2
Associated Gene/TranscriptRpn7-RA
Protein status:LD47143.pep: gold
Preliminary Size:1439
Sequenced Size:1369

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5378 2001-01-01 Release 2 assignment
CG5378 2001-07-04 Blastp of sequenced clone
CG5378 2003-01-01 Sim4 clustering to Release 3
Rpn7 2008-04-29 Release 5.5 accounting
Rpn7 2008-08-15 Release 5.9 accounting
Rpn7 2008-12-18 5.12 accounting

Clone Sequence Records

LD47143.complete Sequence

1369 bp (1369 high quality bases) assembled on 2001-07-04

GenBank Submission: AY052008

> LD47143.complete
CGATTTGACAAAAACAAAATTGAGTTTTGTCAAGAAAATCAACTATTTTT
CTGTGTTTAAAAAACCGAAGCCAACAAATCCGACCAAAATGCCTGCCGAA
AACTTGGAGGAGCAGGGTCTGGAGAAGAACCCGAACCTGGAGCTGGCCCA
GACGAAGTTCCTGCTTACCCTGGCGGAATACAAGCAGGATGCGGCATTGA
AGGCGAAGCTTCTGGAGGCGATTCGCACGGAGAATATGGCCCCGTGGTAC
GAGCACATCTGCTCGGAACTCGGCTGGACCGTAGACAAGGATCTGCTGGC
GCGAATGAAGGAGAACAACCGCGTAGAGGTGGAGCAGCTAGATGCGGCAA
TCGAGGATGCGGAGAAGAATCTGGGCGAGATGGAAGTGCGCGAGGCGAAT
CTTAAGAAGTCAGAGTACTTGTGCCGCATCGGCGACAAGGCTGCCGCAGA
GACTGCCTTCCGCAAGACCTACGAGAAGACCGTTTCCCTGGGTCACCGCC
TGGACATCGTGTTCCATCTGATCCGCTTGGGACTGTTTTACCTTGACCAC
GATCTCATCACTCGCAACATCGACAAGGCCAAGTATCTGATCGAGGAAGG
CGGCGATTGGGACCGACGCAACCGGTTGAAGGTCTACCAGGGTGTTTACT
CGGTGGCGGTGCGTGACTTCAAGGCGGCGGCCACGTTCTTCCTGGACACC
GTAAGCACCTTCACCTCATACGAACTGATGGACTACCCCACCTTCGTGCG
TTACACCGTTTACGTGGCCATGATTGCCCTGCCGCGCAATGAGCTGCGCG
ACAAAGTGATCAAGGGCTCCGAAATCCAGGAGGTGCTCCATGGCCTGCCC
GACGTGAAACAGTTCCTGTTTTCCTTGTACAACTGCCAATATGAGAACTT
CTACGTACACCTGGCCGGCGTAGAGAAGCAATTGCGCTTGGACTACCTCA
TTCATCCCCACTACCGCTACTACGTGCGCGAGATGCGCATTCTGGGCTAC
ACCCAGTTGCTGGAGTCGTATCGCTCCCTCACCCTGCAGTATATGGCCGA
GTCGTTCGGCGTAACAGTGGAATACATTGACCAGGAGCTGGCACGCTTCA
TCGCCGCCGGACGGCTGCATGCCAAGGTGGATCGCGTTGGCGGCATTGTG
GAGACCAATCGGCCTGACAACAAGAACTGGCAGTACCAGGCGACCATCAA
GCAGGGCGATCTGCTGCTCAACCGCATCCAGAAGTTGAGCCGCGTGATAA
ACATCTAATGTAGTTCATATAAAAAGATTTATTCAAATTCAACATTTATT
ACAGTGTAAAGCTAATGCAACGTACAATAATAAAAACGATATAAAACTCA
AAAAAAAAAAAAAAAAAAA

LD47143.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn7-RA 1393 Rpn7-RA 41..1390 1..1350 6750 100 Plus
CG34376-RB 2501 CG34376-RB 2429..2501 1350..1278 365 100 Minus
CG34376.a 2792 CG34376.a 2726..2792 1350..1284 335 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18284205..18285553 1349..1 6745 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:43:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22460661..22462010 1350..1 6750 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22201492..22202841 1350..1 6750 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:12:22 has no hits.

LD47143.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:13:02 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18284205..18285553 1..1349 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:30:58 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn7-RA 1..1170 89..1258 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:15:06 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn7-RA 1..1170 89..1258 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:46:31 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn7-RA 1..1170 89..1258 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:46:29 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn7-RA 1..1170 89..1258 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:14:01 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn7-RA 1..1170 89..1258 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:08:39 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn7-RA 41..1389 1..1349 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:15:06 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn7-RA 41..1389 1..1349 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:46:31 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn7-RA 45..1393 1..1349 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:46:29 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn7-RA 41..1389 1..1349 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:14:01 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn7-RA 45..1393 1..1349 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:13:02 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22460662..22462010 1..1349 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:13:02 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22460662..22462010 1..1349 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:13:02 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22460662..22462010 1..1349 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:46:31 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18286384..18287732 1..1349 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:24:22 Download gff for LD47143.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22201493..22202841 1..1349 100   Minus

LD47143.hyp Sequence

Translation from 0 to 1257

> LD47143.hyp
DLTKTKLSFVKKINYFSVFKKPKPTNPTKMPAENLEEQGLEKNPNLELAQ
TKFLLTLAEYKQDAALKAKLLEAIRTENMAPWYEHICSELGWTVDKDLLA
RMKENNRVEVEQLDAAIEDAEKNLGEMEVREANLKKSEYLCRIGDKAAAE
TAFRKTYEKTVSLGHRLDIVFHLIRLGLFYLDHDLITRNIDKAKYLIEEG
GDWDRRNRLKVYQGVYSVAVRDFKAAATFFLDTVSTFTSYELMDYPTFVR
YTVYVAMIALPRNELRDKVIKGSEIQEVLHGLPDVKQFLFSLYNCQYENF
YVHLAGVEKQLRLDYLIHPHYRYYVREMRILGYTQLLESYRSLTLQYMAE
SFGVTVEYIDQELARFIAAGRLHAKVDRVGGIVETNRPDNKNWQYQATIK
QGDLLLNRIQKLSRVINI*

LD47143.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn7-PA 389 CG5378-PA 1..389 30..418 2005 100 Plus
CSN1b-PA 525 CG3889-PA 172..472 108..402 187 20.6 Plus

LD47143.pep Sequence

Translation from 88 to 1257

> LD47143.pep
MPAENLEEQGLEKNPNLELAQTKFLLTLAEYKQDAALKAKLLEAIRTENM
APWYEHICSELGWTVDKDLLARMKENNRVEVEQLDAAIEDAEKNLGEMEV
REANLKKSEYLCRIGDKAAAETAFRKTYEKTVSLGHRLDIVFHLIRLGLF
YLDHDLITRNIDKAKYLIEEGGDWDRRNRLKVYQGVYSVAVRDFKAAATF
FLDTVSTFTSYELMDYPTFVRYTVYVAMIALPRNELRDKVIKGSEIQEVL
HGLPDVKQFLFSLYNCQYENFYVHLAGVEKQLRLDYLIHPHYRYYVREMR
ILGYTQLLESYRSLTLQYMAESFGVTVEYIDQELARFIAAGRLHAKVDRV
GGIVETNRPDNKNWQYQATIKQGDLLLNRIQKLSRVINI*

LD47143.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16564-PA 389 GF16564-PA 1..389 1..389 2017 96.4 Plus
Dana\GF10799-PA 524 GF10799-PA 171..471 79..373 194 20.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12513-PA 389 GG12513-PA 1..389 1..389 2039 98.2 Plus
Dere\GG13444-PA 525 GG13444-PA 172..472 79..373 190 20.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18475-PA 389 GH18475-PA 1..389 1..389 1932 91.8 Plus
Dgri\GH16963-PA 537 GH16963-PA 175..482 71..373 191 21 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn7-PA 389 CG5378-PA 1..389 1..389 2005 100 Plus
CSN1b-PA 525 CG3889-PA 172..472 79..373 187 20.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10792-PA 389 GI10792-PA 1..389 1..389 1968 93.1 Plus
Dmoj\GI11827-PA 526 GI11827-PA 179..473 85..373 180 20.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23337-PA 389 GL23337-PA 1..389 1..389 2011 96.1 Plus
Dper\GL22061-PA 520 GL22061-PA 167..467 79..373 182 20.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18834-PA 389 GA18834-PA 1..389 1..389 2015 96.4 Plus
Dpse\GA17754-PA 520 GA17754-PA 167..467 79..373 182 20.8 Plus
Dpse\GA26568-PA 461 GA26568-PA 183..419 138..367 154 22.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23647-PA 389 GM23647-PA 1..389 1..389 2068 99.7 Plus
Dsec\GM14913-PA 525 GM14913-PA 172..472 79..373 189 20.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18456-PA 389 GD18456-PA 1..389 1..389 2070 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14389-PA 389 GJ14389-PA 1..389 1..389 1972 93.6 Plus
Dvir\GJ13527-PA 529 GJ13527-PA 169..476 71..373 193 21.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11396-PA 389 GK11396-PA 1..389 1..389 1984 94.3 Plus
Dwil\GK12634-PA 526 GK12634-PA 172..472 79..373 186 20.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Rpn7-PA 389 GE24035-PA 1..389 1..389 2043 98.5 Plus
Dyak\GE22542-PA 525 GE22542-PA 172..472 79..373 191 20.6 Plus