Clone LD47230 Report

Search the DGRC for LD47230

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:472
Well:30
Vector:pOT2
Associated Gene/TranscriptCG4386-RA
Protein status:LD47230.pep: gold
Preliminary Size:1553
Sequenced Size:1503

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4386 2001-01-01 Release 2 assignment
CG4386 2001-07-04 Blastp of sequenced clone
CG4386 2003-01-01 Sim4 clustering to Release 3
CG4386 2008-04-29 Release 5.5 accounting
CG4386 2008-08-15 Release 5.9 accounting
CG4386 2008-12-18 5.12 accounting

Clone Sequence Records

LD47230.complete Sequence

1503 bp (1503 high quality bases) assembled on 2001-07-04

GenBank Submission: AY052010

> LD47230.complete
ATCGGTGGTGTCGCTGTGGAGAAAGCCGGAAAAAGTCTAGAGAAATGAAT
CGAGCCTGGTTGTGTCTGCTGATCTGCCTGGCCTTAAGCTGCGGTCCAAG
CCAATCAGCCAGCCAGGATCGTGCAACGAACCAAACGGCAGCGAGTCCGC
TGCTGAAACAATCTCAGAACACATTTATCCAATGGGTTCTCTCACTTTTG
CCCCAACGTCCCGGCAGTTCGGATTCGGAAAATGCCACTCTGGCCACCTT
GAGCAGCAGCTCTATGATGCCGGACGCGGCATCTACCACATCAACCACCA
CACCAGCCCCGTCTTCCAGCACCACTACAACGAGAAGGGCAACCACTCCG
GCCCCACCCACTTTGAATCCGCCAAGGAATTGCAGCGACTGTGTCTGCGG
AATAGCCAATATACAGAAGAGAATAGTCGGTGGTCAGGAAACGGAGGTTC
ATCAGTATCCCTGGGTGGCTATGTTGCTATATGGCGGAAGGTTCTATTGC
GCCGCCTCCTTGCTCAACGATCAATTCCTGTTGACCGCATCGCATTGCGT
CTATGGCTTTCGAAAGGAAAGAATATCGGTGAGATTACTCGAACATGACC
GCAAGATGTCGCACATGCAAAAGATCGACCGCAAGGTGGCCGAGGTGATC
ACGCATCCCAAGTATAATGCCCGGAACTATGACAACGATATAGCCATCAT
CAAGTTGGATGAGCCGGTGGAGTTCAACGAGGTGCTCCATCCCGTTTGTA
TGCCAACGCCGGGCAGAAGTTTCAAGGGCGAGAATGGCATTGTCACTGGC
TGGGGAGCGCTCAAAGTTGGTGGACCCACTTCCGATACTCTTCAGGAGGT
TCAAGTGCCAATTCTATCGCAGGACGAATGTCGCAAGAGTCGCTATGGCA
ACAAGATCACGGATAACATGCTGTGTGGCGGATACGACGAGGGTGGCAAG
GACTCGTGCCAGGGCGACAGTGGAGGTCCTTTGCACATCGTGGCCAGCGG
AACGCGAGAGCATCAGATCGCCGGCGTTGTCTCGTGGGGCGAGGGCTGTG
CCAAGGCCGGTTATCCTGGCGTCTATGCCAGAGTGAATCGCTACGGAACC
TGGATCAAGAACCTCACCAAACAGGCTTGCCTCTGCCAGCAGGAGACCAA
GAAGATCAAGTAGCGAACATCTGGCTATTTCTGTATCTATTAATAGTTCA
ATACTCTTGCTTGGCTGGCAATGTTTAATATTATATCAGAATTTGTATCT
TCCATCCAATGTGAAAGACAAGTTTTCATTACAAAAAGCTTGTTATTTCC
AAAATCACTAATCTCATATGCCAAGAAACGAACTATTTTCGCCGAAAATA
ACTATGCAATTTCTTGGGATATATGCTCCAAAACTTTTTGCCACCCTTGC
AAGAGTAAGTCAACTTCGGCTTCGTCGAAGATCCCATTTTCAAGCTGTTT
TATATTTATTGATTAAAAGAAAAGTTTCCATAAAAAAAAAAAAAAAAAAA
AAA

LD47230.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG4386-RA 1636 CG4386-RA 135..1618 1..1484 7420 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17686450..17687295 846..1 4230 100 Minus
chr2R 21145070 chr2R 17685750..17686392 1481..839 3200 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:43:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21800030..21800875 846..1 4230 100 Minus
2R 25286936 2R 21799327..21799972 1484..839 3215 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21801229..21802074 846..1 4230 100 Minus
2R 25260384 2R 21800526..21801171 1484..839 3215 99.8 Minus
Blast to na_te.dros performed on 2019-03-15 19:56:45 has no hits.

LD47230.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:57:53 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17685750..17686385 846..1481 100 <- Minus
chr2R 17686451..17687295 1..845 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:31:00 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
CG4386-RA 1..1119 45..1163 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:15:09 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
CG4386-RA 1..1119 45..1163 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:03:49 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
CG4386-RA 1..1119 45..1163 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:46:31 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
CG4386-RA 1..1119 45..1163 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:10:54 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
CG4386-RA 1..1119 45..1163 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:08:45 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
CG4386-RA 26..1506 1..1481 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:15:09 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
CG4386-RA 26..1506 1..1481 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:03:49 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
CG4386-RA 30..1510 1..1481 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:46:31 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
CG4386-RA 26..1506 1..1481 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:10:54 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
CG4386-RA 30..1510 1..1481 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:57:53 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21799330..21799965 846..1481 100 <- Minus
2R 21800031..21800875 1..845 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:57:53 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21799330..21799965 846..1481 100 <- Minus
2R 21800031..21800875 1..845 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:57:53 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21799330..21799965 846..1481 100 <- Minus
2R 21800031..21800875 1..845 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:03:49 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17686835..17687470 846..1481 100 <- Minus
arm_2R 17687536..17688380 1..845 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:24:25 Download gff for LD47230.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21800529..21801164 846..1481 100 <- Minus
2R 21801230..21802074 1..845 100   Minus

LD47230.hyp Sequence

Translation from 2 to 1162

> LD47230.hyp
RWCRCGESRKKSREMNRAWLCLLICLALSCGPSQSASQDRATNQTAASPL
LKQSQNTFIQWVLSLLPQRPGSSDSENATLATLSSSSMMPDAASTTSTTT
PAPSSSTTTTRRATTPAPPTLNPPRNCSDCVCGIANIQKRIVGGQETEVH
QYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDR
KMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCM
PTPGRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGN
KITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCA
KAGYPGVYARVNRYGTWIKNLTKQACLCQQETKKIK*

LD47230.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:30:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG4386-PA 372 CG4386-PA 1..372 15..386 1986 100 Plus
CG18735-PA 364 CG18735-PA 22..323 67..380 893 54.1 Plus
CG9294-PB 352 CG9294-PB 6..344 24..378 710 42.1 Plus
CG3355-PA 314 CG3355-PA 54..313 118..379 612 45.9 Plus
CG11836-PI 281 CG11836-PI 30..280 125..378 600 44.5 Plus

LD47230.pep Sequence

Translation from 44 to 1162

> LD47230.pep
MNRAWLCLLICLALSCGPSQSASQDRATNQTAASPLLKQSQNTFIQWVLS
LLPQRPGSSDSENATLATLSSSSMMPDAASTTSTTTPAPSSSTTTTRRAT
TPAPPTLNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRF
YCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKMSHMQKIDRKVAE
VITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIV
TGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEG
GKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRY
GTWIKNLTKQACLCQQETKKIK*

LD47230.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11616-PA 379 GF11616-PA 1..379 1..372 1662 88.4 Plus
Dana\GF11617-PA 354 GF11617-PA 52..318 101..366 885 57.8 Plus
Dana\GF13273-PA 350 GF13273-PA 78..342 108..364 667 49.8 Plus
Dana\GF21354-PA 315 GF21354-PA 66..314 115..365 629 48.6 Plus
Dana\GF25196-PA 379 GF25196-PA 99..377 90..364 596 41.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20743-PA 372 GG20743-PA 1..372 1..372 1954 97 Plus
Dere\GG20744-PA 364 GG20744-PA 67..323 111..366 897 60.5 Plus
Dere\GG22144-PA 343 GG22144-PA 76..335 111..364 645 48.8 Plus
Dere\GG25012-PA 314 GG25012-PA 65..313 115..365 612 47.5 Plus
Dere\GG13724-PA 376 GG13724-PA 126..374 113..364 584 43.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20776-PA 378 GH20776-PA 8..378 6..372 1582 81.3 Plus
Dgri\GH20777-PA 356 GH20777-PA 48..319 99..370 896 56.4 Plus
Dgri\GH21133-PA 349 GH21133-PA 44..331 83..367 691 49.7 Plus
Dgri\GH13131-PA 318 GH13131-PA 47..317 93..365 630 46.9 Plus
Dgri\GH14456-PA 359 GH14456-PA 109..359 113..366 582 43.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG4386-PA 372 CG4386-PA 1..372 1..372 1986 100 Plus
CG18735-PA 364 CG18735-PA 22..323 53..366 893 54.1 Plus
CG9294-PB 352 CG9294-PB 6..344 10..364 710 42.1 Plus
CG3355-PA 314 CG3355-PA 54..313 104..365 612 45.9 Plus
CG11836-PI 281 CG11836-PI 30..280 111..364 600 44.5 Plus
CG11836-PJ 333 CG11836-PJ 82..332 111..364 600 44.5 Plus
CG4914-PA 374 CG4914-PA 18..373 7..367 587 37.8 Plus
CG4613-PC 374 CG4613-PC 85..372 79..364 582 40.3 Plus
CG4613-PB 374 CG4613-PB 85..372 79..364 582 40.3 Plus
CG9372-PA 408 CG9372-PA 164..402 118..354 544 44.8 Plus
CG11836-PF 223 CG11836-PF 1..222 141..364 502 42.5 Plus
CG11836-PE 223 CG11836-PE 1..222 141..364 502 42.5 Plus
CG11836-PG 223 CG11836-PG 1..222 141..364 502 42.5 Plus
CG11836-PC 223 CG11836-PC 1..222 141..364 502 42.5 Plus
CG11836-PA 223 CG11836-PA 1..222 141..364 502 42.5 Plus
CG11836-PB 223 CG11836-PB 1..222 141..364 502 42.5 Plus
Sb-PB 787 CG4316-PB 403..782 18..354 502 32.7 Plus
Sb-PA 787 CG4316-PA 403..782 18..354 502 32.7 Plus
l(2)k05911-PC 639 CG31728-PC 302..638 52..357 475 35.6 Plus
Np-PB 1041 CG34350-PB 728..1038 57..357 469 33.3 Plus
Np-PA 1041 CG34350-PA 728..1038 57..357 469 33.3 Plus
lint-PC 1693 CG8213-PC 1419..1690 99..358 435 35.2 Plus
lint-PB 1674 CG8213-PB 1318..1671 58..358 431 30.1 Plus
CG7432-PB 721 CG7432-PB 394..720 52..359 427 33.6 Plus
CG1299-PB 442 CG1299-PB 120..434 59..354 424 33.3 Plus
CG1299-PA 511 CG1299-PA 189..503 59..354 424 33.3 Plus
CG8172-PD 371 CG8172-PD 106..365 105..357 417 35.7 Plus
CG8172-PE 545 CG8172-PE 290..539 118..357 415 35.9 Plus
CG8172-PF 561 CG8172-PF 306..555 118..357 415 35.9 Plus
Corin-PC 1397 CG2105-PC 1085..1344 113..355 409 38.8 Plus
Corin-PB 1397 CG2105-PB 1085..1344 113..355 409 38.8 Plus
etaTry-PA 262 CG12386-PA 27..254 126..354 399 36.9 Plus
lambdaTry-PA 272 CG12350-PA 29..256 120..354 396 37.3 Plus
CG32260-PC 395 CG32260-PC 98..389 83..355 395 33 Plus
CG32260-PA 575 CG32260-PA 278..569 83..355 395 33 Plus
ndl-PA 2616 CG10129-PA 1144..1382 126..358 395 35.2 Plus
CG31954-PA 277 CG31954-PA 50..272 126..355 393 36.9 Plus
CG4998-PA 891 CG4998-PA 627..888 118..359 393 36.2 Plus
CG4998-PB 1185 CG4998-PB 921..1182 118..359 393 36.2 Plus
CG7829-PA 253 CG7829-PA 15..252 114..361 383 33.1 Plus
MP1-PA 390 CG1102-PA 97..386 87..356 381 34.4 Plus
MP1-PC 399 CG1102-PC 106..395 87..356 381 34.4 Plus
MP1-PE 400 CG1102-PE 107..396 87..356 381 34.4 Plus
teq-PD 1450 CG4821-PD 1149..1448 71..363 381 29.4 Plus
teq-PF 2379 CG4821-PF 2078..2377 71..363 381 29.4 Plus
teq-PG 2792 CG4821-PG 2491..2790 71..363 381 29.4 Plus
CG16749-PA 265 CG16749-PA 29..258 126..355 378 38.5 Plus
Ser7-PA 397 CG2045-PA 77..390 72..356 368 34 Plus
CG12951-PA 265 CG12951-PA 29..259 126..356 360 36.4 Plus
CG8299-PA 260 CG8299-PA 22..253 121..355 359 33.1 Plus
CG6865-PB 285 CG6865-PB 28..280 118..357 358 30.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20860-PA 396 GI20860-PA 32..396 21..372 1505 81.7 Plus
Dmoj\GI20861-PA 359 GI20861-PA 63..319 111..366 876 58.1 Plus
Dmoj\GI22815-PA 312 GI22815-PA 62..311 114..365 628 48.8 Plus
Dmoj\GI13599-PA 364 GI13599-PA 80..364 68..366 597 41.2 Plus
Dmoj\GI13812-PA 377 GI13812-PA 120..376 116..367 576 45 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17516-PA 377 GL17516-PA 1..377 1..372 1593 84.1 Plus
Dper\GL17517-PA 363 GL17517-PA 65..320 111..366 886 59.1 Plus
Dper\GL14423-PA 314 GL14423-PA 65..313 115..365 608 47.5 Plus
Dper\GL20989-PA 369 GL20989-PA 119..367 113..364 582 43.3 Plus
Dper\GL26150-PA 373 GL26150-PA 100..372 98..367 568 43.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18150-PA 375 GA18150-PA 1..375 1..372 1629 84.5 Plus
Dpse\GA15058-PA 364 GA15058-PA 66..321 111..366 879 58.8 Plus
Dpse\GA21676-PA 333 GA21676-PA 66..325 111..364 640 48.5 Plus
Dpse\GA17401-PA 314 GA17401-PA 65..313 115..365 608 47.5 Plus
Dpse\GA18302-PA 369 GA18302-PA 119..367 113..364 587 43.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15686-PA 372 GM15686-PA 1..372 1..372 1991 98.9 Plus
Dsec\GM15687-PA 364 GM15687-PA 37..323 66..366 894 55.1 Plus
Dsec\GM18483-PA 314 GM18483-PA 65..313 115..365 614 47.1 Plus
Dsec\GM15869-PA 313 GM15869-PA 66..305 131..364 601 50 Plus
Dsec\GM24537-PA 374 GM24537-PA 101..373 98..367 579 43.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25165-PA 372 GD25165-PA 1..372 1..372 1996 99.2 Plus
Dsim\GD25166-PA 364 GD25166-PA 67..323 111..366 896 60.5 Plus
Dsim\GD11631-PA 354 GD11631-PA 87..346 111..364 661 50.4 Plus
Dsim\GD23293-PA 314 GD23293-PA 65..313 115..365 616 47.5 Plus
Dsim\GD12618-PA 394 GD12618-PA 144..392 113..364 575 42.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20595-PA 373 GJ20595-PA 2..373 4..372 1616 82.6 Plus
Dvir\GJ20596-PA 354 GJ20596-PA 61..317 111..366 870 58.3 Plus
Dvir\GJ21756-PA 345 GJ21756-PA 3..339 6..366 742 46.2 Plus
Dvir\GJ23363-PA 318 GJ23363-PA 55..317 104..365 614 46.8 Plus
Dvir\GJ13936-PA 357 GJ13936-PA 107..357 113..366 577 43.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15652-PA 366 GK15652-PA 6..366 4..372 1604 87.7 Plus
Dwil\GK15653-PA 375 GK15653-PA 46..333 41..366 860 50 Plus
Dwil\GK15931-PA 357 GK15931-PA 78..349 102..364 690 49.6 Plus
Dwil\GK23752-PA 324 GK23752-PA 42..323 79..365 637 45.4 Plus
Dwil\GK10288-PA 384 GK10288-PA 133..384 113..366 592 43.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13675-PA 378 GE13675-PA 1..378 1..372 1792 96 Plus
Dyak\GE13676-PA 364 GE13676-PA 67..323 111..366 898 60.9 Plus
Dyak\GE12225-PA 359 GE12225-PA 92..351 111..364 647 48.5 Plus
Dyak\GE18301-PA 314 GE18301-PA 51..313 107..365 616 46.1 Plus
Dyak\GE20019-PA 374 GE20019-PA 124..372 113..364 587 43.7 Plus