Clone LD47405 Report

Search the DGRC for LD47405

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:474
Well:5
Vector:pOT2
Associated Gene/TranscriptAct57B-RA
Protein status:LD47405.pep: gold
Sequenced Size:1722

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Act57B-RA 2009-04-10 Manual selection by Ken Wan

Clone Sequence Records

LD47405.complete Sequence

1722 bp assembled on 2009-09-22

GenBank Submission: BT099815.1

> LD47405.complete
CCAAGCCGTACACACCGTAACTCTTGATTTAATTCACCCGTGGTGCCGTA
AAAAAAACAAAACTAAAACAAAATGTGTGACGATGAAGTTGCTGCTCTGG
TCGTTGACAATGGCTCCGGCATGTGCAAGGCCGGTTTCGCCGGTGATGAC
GCTCCCCGTGCCGTCTTCCCCTCCATCGTCGGTCGTCCACGCCACCAGGG
TGTGATGGTCGGTATGGGCCAGAAGGACTCGTACGTCGGTGATGAGGCCC
AGTCCAAGCGTGGTATCCTCACCCTGAAATACCCCATCGAGCACGGTATC
ATCACCAACTGGGATGATATGGAGAAGATCTGGCACCACACCTTCTACAA
CGAGCTGCGTGTTGCCCCCGAGGAGCACCCCGTCCTGCTGACTGAGGCCC
CCCTGAACCCCAAGGCTAACCGCGAGAAGATGACCCAGATCATGTTTGAG
ACCTTCAACTCGCCCGCCATGTACGTCGCCATCCAGGCCGTGCTCTCCCT
GTACGCCTCCGGTCGTACCACCGGTATCGTTCTGGACTCCGGTGATGGTG
TCTCCCACACCGTCCCCATCTATGAGGGTTATGCTCTGCCCCATGCCATC
CTCCGTCTGGATCTGGCTGGTCGCGATTTGACCGACTACCTGATGAAGAT
CCTGACCGAGCGCGGCTACTCTTTCACCACCACCGCTGAGCGTGAAATTG
TCCGTGACATCAAGGAGAAGTTGTGCTATGTTGCCCTGGACTTCGAGCAG
GAGATGGCCACCGCCGCCGCCTCCACCTCCCTGGAGAAGTCGTACGAGCT
TCCCGACGGACAGGTGATCACCATCGGCAACGAGCGTTTCCGTTGCCCCG
AGTCCCTGTTCCAGCCTTCCTTCCTGGGAATGGAATCCTGCGGCATCCAC
GAGACCGTCTACAACTCCATCATGAAGTGCGATGTGGATATCCGTAAGGA
CCTGTACGCCAACATCGTCATGTCCGGTGGCACCACCATGTACCCCGGTA
TTGCCGATCGTATGCAGAAGGAGATCACCTCCCTGGCCCCATCCACCATC
AAGATCAAGATCATTGCTCCCCCAGAGCGCAAATACTCCGTCTGGATCGG
TGGCTCCATCCTGGCCTCTCTGTCCACCTTCCAGCAGATGTGGATCTCCA
AGGAGGAGTACGACGAGTCCGGCCCTGGCATCGTCCACCGCAAGTGCTTC
TAAGCAGTTGCAGTTGCCTAGCACCAACACTAGCACCACCCGGTCTACTC
ACCTGTCTCCTGCTCATCTGGTCCTGCTATTTGTGGTGGTTCTGGGTGTG
TGGGCGGCTGGTGCTCCACCGGCAAAAACAACAAACACCACCACCATCCA
ACCATTTGTTTTTGAATGTCATTATTTACCAACGTGTCATCCTTGGTTCG
AGAATACTCTTTTGTACTGACTGAACACAACACCATCAATCAAAATGAAT
TGTCAATCTAATGCCACGGACCGCGATCCCCATCCACTTGTTAATCGCTC
GCGGTTTCCTTAAATGTTGATCGCCATTTGATTGTTTTACGAATGAACCG
ACACCCTCATGTATTTTGTACAGAACCTAACAACTTCCCCGATAGAGCGG
ATGGGGTCTATTGACTACGAAATGTAAAATAATCTCATGATTGTAATATT
AATTAAAACAATTTATAATTATTTATAAATAAAAACGATTTTTTAGATTT
AAAAAAAAAAAAAAAAAAAAAA

LD47405.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Act57B-RA 1885 Act57B-RA 102..1803 1..1702 8510 100 Plus
Act57B-RC 2384 Act57B-RC 816..2384 112..1680 7845 100 Plus
Act87E-RA 1893 Act87E-RA 118..1254 69..1205 4290 91.8 Plus
Act57B-RC 2384 Act57B-RC 18..130 1..113 565 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16831287..16832875 112..1700 7870 99.7 Plus
chr3R 27901430 chr3R 9251852..9252988 69..1205 4275 91.7 Plus
chrX 22417052 chrX 5795050..5796186 68..1204 4170 91.1 Plus
chr2R 21145070 chr2R 1901449..1902589 1208..68 3080 84.7 Minus
chr3L 24539361 chr3L 21974272..21975211 60..999 3020 88.1 Plus
chr3R 27901430 chr3R 11265222..11266153 69..1000 2995 88.1 Plus
chr3R 27901430 chr3R 11266211..11266418 997..1204 785 91.8 Plus
chr3L 24539361 chr3L 21975571..21975780 997..1206 750 90.5 Plus
chr2R 21145070 chr2R 16830496..16830608 1..113 565 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
snoRNA:660-RA 96 CR33780-RA 1..96 1239..1334 480 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20944843..20946433 112..1702 7955 100 Plus
3R 32079331 3R 13426600..13427736 69..1205 4290 91.8 Plus
X 23542271 X 5902693..5903829 68..1204 4170 91.1 Plus
2R 25286936 2R 6014265..6015405 1208..68 3080 84.7 Minus
3L 28110227 3L 21985338..21986277 60..999 3020 88.1 Plus
3R 32079331 3R 15440612..15441543 69..1000 2980 88 Plus
3R 32079331 3R 15441601..15441808 997..1204 785 91.8 Plus
3L 28110227 3L 21986637..21986846 997..1206 750 90.5 Plus
2R 25286936 2R 20944045..20944157 1..113 565 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20946042..20947632 112..1702 7955 100 Plus
3R 31820162 3R 13167431..13168567 69..1205 4290 91.8 Plus
X 23527363 X 5910791..5911927 68..1204 4170 91.1 Plus
3L 28103327 3L 21978438..21979377 60..999 3020 88 Plus
3R 31820162 3R 15181480..15182374 106..1000 2960 88.7 Plus
2R 25260384 2R 6015905..6016604 767..68 2000 85.7 Minus
2R 25260384 2R 6015464..6015894 1208..778 1135 84.2 Minus
3R 31820162 3R 15182432..15182639 997..1204 785 91.8 Plus
3L 28103327 3L 21979737..21979946 997..1206 750 90.4 Plus
2R 25260384 2R 20945244..20945356 1..113 565 100 Plus
2R 25260384 2R 16776042..16776155 484..597 180 77.1 Plus
2R 25260384 2R 16775832..16775902 271..341 160 81.6 Plus
Blast to na_te.dros performed on 2019-03-16 12:10:35 has no hits.

LD47405.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:11:37 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16830496..16830607 1..112 100 -> Plus
chr2R 16831288..16832818 113..1643 99 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:11 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
Act57B-RA 1..1131 73..1203 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:32:57 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
Act57B-RA 1..1131 73..1203 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:18:25 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
Act57B-RA 1..1131 73..1203 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:39:35 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
Act57B-RA 1..1131 73..1203 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:44:10 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
snoRNA:660-RA 1..96 1239..1334 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-22 13:25:18 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
Act57B-RA 18..1717 1..1700 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:32:56 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
Act57B-RA 18..1717 1..1700 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:18:25 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
Act57B-RA 25..1724 1..1700 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:39:35 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
Act57B-RA 25..1724 1..1700 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:37 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20944045..20944156 1..112 100 -> Plus
2R 20944844..20946431 113..1700 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:37 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20944045..20944156 1..112 100 -> Plus
2R 20944844..20946431 113..1700 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:37 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20944045..20944156 1..112 100 -> Plus
2R 20944844..20946431 113..1700 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:18:25 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16831550..16831661 1..112 100 -> Plus
arm_2R 16832349..16833936 113..1700 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:17:22 Download gff for LD47405.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20946043..20947630 113..1700 100   Plus
2R 20945244..20945355 1..112 100 -> Plus

LD47405.pep Sequence

Translation from 72 to 1202

> LD47405.pep
MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ
KDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPE
EHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTT
GIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYS
FTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVIT
IGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVM
SGGTTMYPGIADRMQKEITSLAPSTIKIKIIAPPERKYSVWIGGSILASL
STFQQMWISKEEYDESGPGIVHRKCF*

LD47405.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12208-PA 376 GF12208-PA 1..376 1..376 2028 100 Plus
Dana\GF17602-PA 376 GF17602-PA 1..376 1..376 2019 99.2 Plus
Dana\GF18300-PA 376 GF18300-PA 1..376 1..376 1991 97.3 Plus
Dana\GF13827-PA 376 GF13827-PA 1..376 1..376 1977 96 Plus
Dana\GF10940-PA 376 GF10940-PA 1..376 1..376 1973 96.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22068-PA 376 GG22068-PA 1..376 1..376 2028 100 Plus
Dere\GG19688-PA 376 GG19688-PA 1..376 1..376 2019 99.2 Plus
Dere\GG16929-PA 376 GG16929-PA 1..376 1..376 1991 97.3 Plus
Dere\GG10840-PA 376 GG10840-PA 1..376 1..376 1985 96.3 Plus
Dere\GG18797-PA 376 GG18797-PA 1..376 1..376 1982 96.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22007-PA 376 GH22007-PA 1..376 1..376 2028 100 Plus
Dgri\GH19045-PA 376 GH19045-PA 1..376 1..376 2019 99.2 Plus
Dgri\GH19077-PA 376 GH19077-PA 1..376 1..376 1985 97.1 Plus
Dgri\GH24372-PA 376 GH24372-PA 1..376 1..376 1982 96.3 Plus
Dgri\GH20408-PA 376 GH20408-PA 1..376 1..376 1981 96 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
Act57B-PA 376 CG10067-PA 1..376 1..376 1967 100 Plus
Act87E-PC 376 CG18290-PC 1..376 1..376 1958 99.2 Plus
Act87E-PB 376 CG18290-PB 1..376 1..376 1958 99.2 Plus
Act87E-PA 376 CG18290-PA 1..376 1..376 1958 99.2 Plus
Act88F-PA 376 CG5178-PA 1..376 1..376 1933 97.3 Plus
Act42A-PA 376 CG12051-PA 1..376 1..376 1921 96.3 Plus
Act5C-PE 376 CG4027-PE 1..376 1..376 1919 96.3 Plus
Act5C-PD 376 CG4027-PD 1..376 1..376 1919 96.3 Plus
Act5C-PC 376 CG4027-PC 1..376 1..376 1919 96.3 Plus
Act5C-PA 376 CG4027-PA 1..376 1..376 1919 96.3 Plus
Act5C-PB 376 CG4027-PB 1..376 1..376 1919 96.3 Plus
Act79B-PB 376 CG7478-PB 1..376 1..376 1911 96.5 Plus
Act79B-PA 376 CG7478-PA 1..376 1..376 1911 96.5 Plus
Arp53D-PB 411 CG5409-PB 47..411 7..376 1272 64.3 Plus
Arp1-PA 376 CG6174-PA 12..376 9..376 1081 54.3 Plus
Arp2-PB 394 CG9901-PB 9..388 9..373 915 46.8 Plus
Arp2-PA 394 CG9901-PA 9..388 9..373 915 46.8 Plus
Arp2-PC 399 CG9901-PC 9..393 9..373 906 46 Plus
Arp3-PB 418 CG7558-PB 7..407 8..370 646 35.8 Plus
Arp3-PA 418 CG7558-PA 7..407 8..370 646 35.8 Plus
Bap55-PA 425 CG6546-PA 11..424 4..375 575 32.7 Plus
Arp6-PA 398 CG11678-PA 4..391 7..367 418 26.1 Plus
Arp5-PB 648 CG7940-PB 7..246 9..228 218 22.9 Plus
Arp5-PA 648 CG7940-PA 7..246 9..228 218 22.9 Plus
Arp10-PB 378 CG12235-PB 10..361 5..366 212 21.9 Plus
Arp10-PA 378 CG12235-PA 10..361 5..366 212 21.9 Plus
Arp5-PB 648 CG7940-PB 514..629 252..367 156 28.4 Plus
Arp5-PA 648 CG7940-PA 514..629 252..367 156 28.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19711-PA 376 GI19711-PA 1..376 1..376 2028 100 Plus
Dmoj\GI24339-PA 376 GI24339-PA 1..376 1..376 2019 99.2 Plus
Dmoj\GI23222-PA 376 GI23222-PA 1..376 1..376 1985 97.1 Plus
Dmoj\GI15312-PA 376 GI15312-PA 1..376 1..376 1982 96.3 Plus
Dmoj\GI19595-PA 376 GI19595-PA 1..376 1..376 1982 96 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17061-PA 376 GL17061-PA 1..376 1..376 2028 100 Plus
Dper\GL14888-PA 376 GL14888-PA 1..376 1..376 1982 96.3 Plus
Dper\GL17787-PA 376 GL17787-PA 1..376 1..376 1981 96 Plus
Dper\GL26327-PA 376 GL26327-PA 1..376 1..376 1948 94.1 Plus
Dper\GL23756-PA 371 GL23756-PA 1..371 1..376 1699 86 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24346-PA 376 GA24346-PA 1..376 1..376 2028 100 Plus
Dpse\GA14877-PB 376 GA14877-PB 1..376 1..376 2019 99.2 Plus
Dpse\GA14877-PA 376 GA14877-PA 1..376 1..376 2019 99.2 Plus
Dpse\GA26730-PA 376 GA26730-PA 1..376 1..376 1991 97.3 Plus
Dpse\GA17886-PA 376 GA17886-PA 1..376 1..376 1982 96.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24109-PA 376 GM24109-PA 1..376 1..376 1986 97.9 Plus
Dsec\GM16492-PA 376 GM16492-PA 1..376 1..376 1985 96.3 Plus
Dsec\GM12447-PA 376 GM12447-PA 1..376 1..376 1982 96.3 Plus
Dsec\GM22426-PA 376 GM22426-PA 1..376 1..376 1973 96.5 Plus
Dsec\GM21720-PA 376 GM21720-PA 12..376 7..376 1328 64.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11548-PA 376 GD11548-PA 1..376 1..376 2028 100 Plus
Dsim\GD18909-PA 376 GD18909-PA 1..376 1..376 2019 99.2 Plus
Dsim\Act88F-PA 376 GD19025-PA 1..376 1..376 1991 97.3 Plus
Dsim\GD10342-PA 376 GD10342-PA 1..376 1..376 1985 96.3 Plus
Dsim\GD16764-PA 376 GD16764-PA 1..376 1..376 1982 96.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\ActC2-PA 376 GJ17479-PA 1..376 1..376 2028 100 Plus
Dvir\ActE1-PA 376 GJ10425-PA 1..376 1..376 2019 99.2 Plus
Dvir\ActE2-PA 376 GJ22881-PA 1..376 1..376 1985 97.1 Plus
Dvir\GJ18395-PA 376 GJ18395-PA 1..376 1..376 1982 96 Plus
Dvir\GJ14747-PA 376 GJ14747-PA 1..376 1..376 1982 96.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23336-PA 376 GK23336-PA 1..376 1..376 2028 100 Plus
Dwil\GK13943-PA 376 GK13943-PA 1..376 1..376 2019 99.2 Plus
Dwil\GK11462-PA 376 GK11462-PA 1..376 1..376 1991 97.3 Plus
Dwil\GK21751-PA 376 GK21751-PA 1..376 1..376 1985 96.3 Plus
Dwil\GK20124-PA 376 GK20124-PA 1..376 1..376 1982 96.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12149-PA 376 GE12149-PA 1..376 1..376 2028 100 Plus
Dyak\GE26273-PA 376 GE26273-PA 1..376 1..376 2019 99.2 Plus
Dyak\GE24312-PA 376 GE24312-PA 1..376 1..376 1991 97.3 Plus
Dyak\Act57B-PA 376 GE17558-PA 1..376 1..376 1982 96.3 Plus
Dyak\GE19434-PA 376 GE19434-PA 1..376 1..376 1981 96 Plus

LD47405.hyp Sequence

Translation from 72 to 1202

> LD47405.hyp
MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ
KDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPE
EHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTT
GIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYS
FTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVIT
IGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVM
SGGTTMYPGIADRMQKEITSLAPSTIKIKIIAPPERKYSVWIGGSILASL
STFQQMWISKEEYDESGPGIVHRKCF*

LD47405.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Act57B-PA 376 CG10067-PA 1..376 1..376 1967 100 Plus
Act87E-PC 376 CG18290-PC 1..376 1..376 1958 99.2 Plus
Act87E-PB 376 CG18290-PB 1..376 1..376 1958 99.2 Plus
Act87E-PA 376 CG18290-PA 1..376 1..376 1958 99.2 Plus
Act88F-PA 376 CG5178-PA 1..376 1..376 1933 97.3 Plus