Clone LD47455 Report

Search the DGRC for LD47455

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:474
Well:55
Vector:pOT2
Associated Gene/TranscriptCG10754-RA
Protein status:LD47455.pep: gold
Preliminary Size:1099
Sequenced Size:1001

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10754 2001-01-01 Release 2 assignment
CG10754 2002-05-17 Blastp of sequenced clone
CG10754 2003-01-01 Sim4 clustering to Release 3
CG10754 2008-04-29 Release 5.5 accounting
CG10754 2008-08-15 Release 5.9 accounting
CG10754 2008-12-18 5.12 accounting

Clone Sequence Records

LD47455.complete Sequence

1001 bp (1001 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118970

> LD47455.complete
TGACAACCCTGTTCTGTACAACAAATTTTCATGAAATTTTACCAACGCAA
AACGTTTTTCCTTCGTGCGGTTGAAAACTAAAATAAAGTTTACAAAATGG
ACTTCCAAAACCGCGCCGGCGGCAAGACCGGCAGCGGAGGCGTAGCCTCC
TGGTCGGAGACGAACCGCGACCGCAAGGAGCGACTGCGTCAACTGGCCCT
GGAGACAATCGATCTGAACAAGGATCCGTACTTCATGAAGAACCATCTGG
GCTCCTACGAGTGCAAACTCTGCCTGACGCTGCACAACAACGAGGGCAGC
TATTTGGCCCACACGCAGGGCAAGAAGCATCAGGATAATCTGGCAAGAAG
AGCCGCCAAGGAGGCAAAGGAGGCACCCTCTTCGCTGCTGGCGCCCGAGA
AGCCCCGCGTGGAACCGAAGAAGTTCGTCAAGATTGGACGACCCGGCTAC
CGGGTGACCAAGCAGCGTGAACTCAGCAACGGCCAGCAGTCGTTGCTCTT
TCAGGTGGACTACCCGGAAATCACGGAGTCCATTGTTCCGCGTCACCGCT
TCATGTCCGCCTACGAGCAAAAGATCGAGCCGCCAGACCGCAAGTGGCAG
TACCTTCTCTTTGCCGCCGAGCCGTACGAGACCATAGGGTTCAAGGTGCC
GTCCCGCGAAGTGGAGAAGAGTGAGGGCAAGTTCTGGACGCACTGGAACC
GTGACACCAAGCAGTTCTTCCTTCAGTTCGCCTTCAAGTTCGAACCTAAG
ATCCTGCCGCCACCGCCGCCGAATCTACATAGGGCACTAGGCCCCCCAGG
CGGATTCCCCATGCCGGGACCGCCACGTCCTGCTATGCATCCCATGTTCA
ATGGCGTTCATCCACCGCCACCCATGCTTTCAAACAACTAATTCATCGAC
AATGTTTACGGGATTTCTCCAAACGCAAGCCGATTACCACAGAAATATTC
AAATAATAAACAATTTTCTACTTAATAAAAAAAAAAAAAAAAAAAAAAAA
A

LD47455.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG10754-RA 976 CG10754-RA 1..976 1..976 4880 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12803385..12804360 976..1 4820 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:44:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12813027..12814003 977..1 4885 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12806127..12807103 977..1 4885 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:17:02 has no hits.

LD47455.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:18:06 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12803385..12804360 1..976 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:31:20 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
CG10754-RA 1..795 97..891 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:48:28 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
CG10754-RA 1..795 97..891 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:46:59 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
CG10754-RA 1..795 97..891 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:41:13 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
CG10754-RA 1..795 97..891 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:14:28 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
CG10754-RA 1..795 97..891 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:25:25 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
CG10754-RA 1..976 1..976 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:48:28 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
CG10754-RA 1..976 1..976 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:46:59 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
CG10754-RA 17..992 1..976 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:41:13 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
CG10754-RA 1..976 1..976 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:14:28 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
CG10754-RA 17..992 1..976 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:18:06 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12813028..12814003 1..976 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:18:06 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12813028..12814003 1..976 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:18:06 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12813028..12814003 1..976 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:46:59 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12806128..12807103 1..976 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:13:17 Download gff for LD47455.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12806128..12807103 1..976 100   Minus

LD47455.pep Sequence

Translation from 96 to 890

> LD47455.pep
MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNH
LGSYECKLCLTLHNNEGSYLAHTQGKKHQDNLARRAAKEAKEAPSSLLAP
EKPRVEPKKFVKIGRPGYRVTKQRELSNGQQSLLFQVDYPEITESIVPRH
RFMSAYEQKIEPPDRKWQYLLFAAEPYETIGFKVPSREVEKSEGKFWTHW
NRDTKQFFLQFAFKFEPKILPPPPPNLHRALGPPGGFPMPGPPRPAMHPM
FNGVHPPPPMLSNN*

LD47455.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10865-PA 261 GF10865-PA 1..261 1..260 1210 95.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13802-PA 264 GG13802-PA 1..264 1..264 1398 99.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:35:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14494-PA 260 GH14494-PA 1..260 1..260 1289 94.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
Sf3a2-PA 264 CG10754-PA 1..264 1..264 1441 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:35:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13650-PA 260 GI13650-PA 1..260 1..260 1299 95.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22896-PA 260 GL22896-PA 1..260 1..260 1345 96.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10545-PA 260 GA10545-PA 1..260 1..260 1345 96.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:35:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24628-PA 264 GM24628-PA 1..264 1..264 1398 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12694-PA 264 GD12694-PA 1..264 1..264 1398 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13983-PA 260 GJ13983-PA 1..260 1..260 1296 95 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16828-PA 260 GK16828-PA 1..260 1..260 1350 96.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20095-PA 264 GE20095-PA 1..264 1..264 1398 99.6 Plus

LD47455.hyp Sequence

Translation from 96 to 890

> LD47455.hyp
MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNH
LGSYECKLCLTLHNNEGSYLAHTQGKKHQDNLARRAAKEAKEAPSSLLAP
EKPRVEPKKFVKIGRPGYRVTKQRELSNGQQSLLFQVDYPEITESIVPRH
RFMSAYEQKIEPPDRKWQYLLFAAEPYETIGFKVPSREVEKSEGKFWTHW
NRDTKQFFLQFAFKFEPKILPPPPPNLHRALGPPGGFPMPGPPRPAMHPM
FNGVHPPPPMLSNN*

LD47455.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG10754-PA 264 CG10754-PA 1..264 1..264 1441 100 Plus