Clone LD47479 Report

Search the DGRC for LD47479

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:474
Well:79
Vector:pOT2
Associated Gene/TranscriptGem2-RA
Protein status:LD47479.pep: gold
Preliminary Size:1330
Sequenced Size:1181

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10419 2001-01-01 Release 2 assignment
CG10419 2003-01-01 Sim4 clustering to Release 3
CG10419 2003-01-15 Blastp of sequenced clone
CG10419 2008-04-29 Release 5.5 accounting
CG10419 2008-08-15 Release 5.9 accounting
CG10419 2008-12-18 5.12 accounting

Clone Sequence Records

LD47479.complete Sequence

1181 bp (1181 high quality bases) assembled on 2003-01-15

GenBank Submission: AY069703

> LD47479.complete
CACTGCTTGGCGGCTTTGAGTTTGCACGACTAATTCAACACAAATTTATT
AAATACAGTGTAAACATGCAGCATGAGCCCGAAGATCAGACTTTTCAACT
CCAGGCACTGGAGATCTGTGAGCCGGATAGCAGTTTTGACCCCCAGAAGC
CGCCAGAGTCCGGGGAAGAGTACCTAATGCACATGTTCTACGAGAGGAAG
CGATGTCCAGCTGTGGTGACCAAAAGATCATCCAAAATCAGGAATAACAC
GGGAAATACCACTTTAGAGATGTTGGACAATCCCGAGTTGCCTCCGTTCA
AGTGCCTGCTGCCCACGCCCGAATGGCGGGATGAGCAAGTTAAATCCTTC
CAAGCAGCCCGCTCCCAGGTCCTAGTTCTTCGTAAGGAGTTGGCCAACAA
CAACTACGACCAGTCCGGGGAACCACCTTTGACTTCCGACCAGGAGAAAT
GGAAGGAATTCTGCCGGAATCAGCAGCCCCTCCTGAGCACCCTGCTCCAT
TTGACCCAAAACGACTTGGAGCTCTTGCTGGAAATGCTCAGCAAGTGGCT
GCAGGATCCCAACACCACGGTAGACCTTCTCCACGATGTCTGGCTGGCTC
GCTGGCTGTATGCCACCTTGGTCTGCCTCCACCTTCCACTGGAACCTCAC
GTGTTCAGCACCCTTCGATACATCGCCCGAACCTGCATCCATCTGAGAAA
TCAACTTAAGGAGGACGAAGTGCAACGGGCAGCTCCCTACAACCTACTAC
TAACGCTCACCGTTCAGGTTTTCGCACAGAATGATTTCAAGGATTACATA
TAGGTATCATATTCCCAGTTTAGAAACCACTAATTTAAGCGCAAATTCGA
CTATTTTGTTAACTAAAAAGCCAAAAGCTACGCTGGTAATTTTGTTTATA
TAATTACTCTACGTTTAGATACTATTTTTATAGTTTTCTGTGGCTGAATT
ATATTCTTTTGGTTAGAAAACAGATTTATTTATGCATATCAATCAAGAGA
CAACATATTGTTAATGAACCTAAAAATTAGATCGTAAAACATAAAAGTTT
AAATATAAAAGTAATGATAATATCTTAATTTGAATGAAGAAGTTACCCAT
TTAACCCATGTACACAAGTCAATTATTTCTGGAAAATGTACTGAAATGTG
ACCATTTATTGAAAAAAAAAAAAAAAAAAAA

LD47479.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG10419-RA 1286 CG10419-RA 122..1286 1..1165 5825 100 Plus
CG10419.b 1305 CG10419.b 199..1305 59..1165 5535 100 Plus
CG10419.a 1170 CG10419.a 64..1170 59..1165 5535 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19088687..19089566 1161..282 4400 100 Minus
chr3L 24539361 chr3L 19089618..19089898 281..1 1390 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:44:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19099119..19100002 1165..282 4420 100 Minus
3L 28110227 3L 19100054..19100334 281..1 1405 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19092219..19093102 1165..282 4420 100 Minus
3L 28103327 3L 19093154..19093434 281..1 1405 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:45:39 has no hits.

LD47479.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:46:16 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19088687..19089566 282..1161 100 <- Minus
chr3L 19089618..19089898 1..281 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:31:27 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
CG10419-RA 1..738 66..803 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:06 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
Gem2-RA 1..738 66..803 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:28 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
Gem2-RA 1..738 66..803 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:02 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
CG10419-RA 1..738 66..803 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:41:42 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
Gem2-RA 1..738 66..803 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:11:42 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
CG10419-RA 1..1161 1..1161 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:06 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
Gem2-RA 1..1161 1..1161 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:28 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
Gem2-RA 22..1182 1..1161 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:02 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
CG10419-RA 1..1161 1..1161 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:41:42 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
Gem2-RA 22..1182 1..1161 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:46:16 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19099123..19100002 282..1161 100 <- Minus
3L 19100054..19100334 1..281 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:46:16 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19099123..19100002 282..1161 100 <- Minus
3L 19100054..19100334 1..281 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:46:16 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19099123..19100002 282..1161 100 <- Minus
3L 19100054..19100334 1..281 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:28 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19092223..19093102 282..1161 100 <- Minus
arm_3L 19093154..19093434 1..281 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:15 Download gff for LD47479.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19092223..19093102 282..1161 100 <- Minus
3L 19093154..19093434 1..281 100   Minus

LD47479.hyp Sequence

Translation from 2 to 802

> LD47479.hyp
LLGGFEFARLIQHKFIKYSVNMQHEPEDQTFQLQALEICEPDSSFDPQKP
PESGEEYLMHMFYERKRCPAVVTKRSSKIRNNTGNTTLEMLDNPELPPFK
CLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQEKW
KEFCRNQQPLLSTLLHLTQNDLELLLEMLSKWLQDPNTTVDLLHDVWLAR
WLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLL
TLTVQVFAQNDFKDYI*

LD47479.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
Gem2-PB 245 CG10419-PB 1..245 22..266 1311 100 Plus
Gem2-PA 245 CG10419-PA 1..245 22..266 1311 100 Plus

LD47479.pep Sequence

Translation from 65 to 802

> LD47479.pep
MQHEPEDQTFQLQALEICEPDSSFDPQKPPESGEEYLMHMFYERKRCPAV
VTKRSSKIRNNTGNTTLEMLDNPELPPFKCLLPTPEWRDEQVKSFQAARS
QVLVLRKELANNNYDQSGEPPLTSDQEKWKEFCRNQQPLLSTLLHLTQND
LELLLEMLSKWLQDPNTTVDLLHDVWLARWLYATLVCLHLPLEPHVFSTL
RYIARTCIHLRNQLKEDEVQRAAPYNLLLTLTVQVFAQNDFKDYI*

LD47479.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10782-PA 245 GF10782-PA 1..245 1..245 974 73.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13425-PA 245 GG13425-PA 1..245 1..245 1211 93.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16947-PA 247 GH16947-PA 1..247 1..245 910 68.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
Gem2-PB 245 CG10419-PB 1..245 1..245 1311 100 Plus
Gem2-PA 245 CG10419-PA 1..245 1..245 1311 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11807-PA 258 GI11807-PA 1..258 1..245 895 67.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21755-PA 245 GL21755-PA 1..245 1..245 862 69.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10306-PA 245 GA10306-PA 1..245 1..245 867 70.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14892-PA 245 GM14892-PA 1..245 1..245 1259 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12302-PA 245 GD12302-PA 1..245 1..245 1281 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13510-PA 260 GJ13510-PA 1..260 1..245 848 65.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12484-PA 268 GK12484-PA 5..262 4..245 826 62.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22781-PA 245 GE22781-PA 1..245 1..245 1201 92.2 Plus
Dyak\GE22520-PA 245 GE22520-PA 1..245 1..245 1201 92.2 Plus