Clone LD47488 Report

Search the DGRC for LD47488

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:474
Well:88
Vector:pOT2
Associated Gene/TranscriptRpS3-RA
Protein status:LD47488.pep: gold
Preliminary Size:863
Sequenced Size:928

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6779 2002-01-01 Sim4 clustering to Release 2
CG6779 2002-05-18 Blastp of sequenced clone
CG6779 2003-01-01 Sim4 clustering to Release 3
RpS3 2008-04-29 Release 5.5 accounting
RpS3 2008-08-15 Release 5.9 accounting
RpS3 2008-12-18 5.12 accounting

Clone Sequence Records

LD47488.complete Sequence

928 bp (928 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118971

> LD47488.complete
GCACACTGGCCTCTTTCTTTTCTGCGCACCACGTTTCCGATTCGACGTCA
AAATGAATGCGAACCTTCCGATTTCCAAGAAACGCAAGTTCGTTTCCGAT
GGCATCTTCAAGGCTGAATTGAACGAGTTCCTGACTCGCGAACTCGCCGA
GGATGGCTACTCCGGCGTGGAGGTCCGTGTGACCCCCTCTCGCACTGAGA
TCATCATCATGGCCACCAAGACCCAGCAGGTGCTGGGCGAGAAGGGCCGT
CGCATTCGGGAGCTGACCGCCATGGTGCAGAAGCGTTTCAACTTCGAGAC
CGGACGCATTGAGTTGTACGCCGAGAAGGTGGCCGCTCGTGGCCTGTGCG
CCATTGCCCAGGCTGAGTCGCTGAGGTACAAGCTCACCGGAGGACTGGCC
GTCCGTCGTGCTTGCTATGGTGTGCTCCGCTACATCATGGAGTCGGGAGC
CAAGGGCTGCGAGGTCGTCGTGTCCGGCAAACTGCGTGGTCAGCGTGCCA
AGTCGATGAAATTCGTCGATGGCCTGATGATCCATTCGGGAGATCCGTGC
AACGACTATGTCGAGACCGCCACCCGTCATGTGCTCCTCCGCCAGGGAGT
GCTTGGTATCAAGGTCAAGGTCATGTTGCCCTACGACCCCAAGAACAAGA
TCGGCCCCAAGAAGCCGCTGCCCGACAATGTGTCCGTTGTGGAGCCCAAG
GAGGAGAAGATCTACGAGACGCCCGAGACCGAGTACAAGATCCCCCCGCC
CAGCAAGCCACTGGACGATCTGTCCGAGGCGAAAGTTTTGTAAACCTAGT
TTTACTGTTCATCCAATGAGCGACTAGCTGAAAGAGTTGCCCTCAAATAC
AACAAAACAACAGAAACAAAACAAAAACACATAATAATTCAATAAACAAA
ATCAATAAGTAAAAAAAAAAAAAAAAAA

LD47488.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
RpS3-RA 1169 RpS3-RA 37..948 1..912 4560 100 Plus
RpS3.b 1150 RpS3.b 18..929 1..912 4560 100 Plus
RpS3.a 798 RpS3.a 244..797 359..912 2770 100 Plus
RpS3.a 798 RpS3.a 18..247 1..230 1150 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19182551..19183374 87..910 4045 99.4 Plus
chr3R 27901430 chr3R 19182202..19182289 1..88 440 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:44:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23359152..23359977 87..912 4130 100 Plus
3R 32079331 3R 23358803..23358890 1..88 440 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23099983..23100808 87..912 4130 100 Plus
3R 31820162 3R 23099634..23099721 1..88 440 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:17:08 has no hits.

LD47488.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:18:09 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19182202..19182289 1..88 100 -> Plus
chr3R 19182553..19183374 89..910 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:31:28 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3-RA 1..741 53..793 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:44:05 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3-RA 1..741 53..793 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:47:04 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3-RA 1..741 53..793 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:36:16 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3-RA 1..741 53..793 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:14:33 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3-RA 1..741 53..793 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:18:57 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3-RA 1..910 1..910 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:44:05 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3-RA 1..910 1..910 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:47:04 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3-RA 1..901 10..910 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:36:16 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3-RA 1..910 1..910 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:14:33 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
RpS3-RB 1..901 10..910 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:18:09 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23358803..23358890 1..88 100 -> Plus
3R 23359154..23359975 89..910 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:18:09 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23358803..23358890 1..88 100 -> Plus
3R 23359154..23359975 89..910 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:18:09 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23358803..23358890 1..88 100 -> Plus
3R 23359154..23359975 89..910 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:47:04 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19184525..19184612 1..88 100 -> Plus
arm_3R 19184876..19185697 89..910 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:08:38 Download gff for LD47488.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23099985..23100806 89..910 100   Plus
3R 23099634..23099721 1..88 100 -> Plus

LD47488.hyp Sequence

Translation from 0 to 792

> LD47488.hyp
HTGLFLFCAPRFRFDVKMNANLPISKKRKFVSDGIFKAELNEFLTRELAE
DGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFET
GRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGA
KGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGV
LGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPP
SKPLDDLSEAKVL*

LD47488.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
RpS3-PB 246 CG6779-PB 1..246 18..263 1252 100 Plus
RpS3-PA 246 CG6779-PA 1..246 18..263 1252 100 Plus

LD47488.pep Sequence

Translation from 52 to 792

> LD47488.pep
MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEI
IIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCA
IAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAK
SMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKI
GPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL*

LD47488.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16244-PA 246 GF16244-PA 1..246 1..246 1274 98.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11202-PA 246 GG11202-PA 1..246 1..246 1271 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20000-PA 246 GH20000-PA 1..246 1..246 1259 96.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
RpS3-PB 246 CG6779-PB 1..246 1..246 1252 100 Plus
RpS3-PA 246 CG6779-PA 1..246 1..246 1252 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22047-PA 246 GI22047-PA 1..246 1..246 1266 98 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13632-PA 246 GL13632-PA 1..246 1..246 1274 98.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19858-PA 246 GA19858-PA 1..246 1..246 1274 98.4 Plus
Dpse\GA25150-PA 204 GA25150-PA 1..204 43..246 1054 98 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26502-PA 246 GM26502-PA 1..246 1..246 1285 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21014-PA 246 GD21014-PA 1..246 1..246 1285 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\RpS3-PA 246 GJ24100-PA 1..246 1..246 1254 96.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14111-PA 244 GK14111-PA 2..244 4..246 1252 97.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS3-PA 246 GE10368-PA 1..246 1..246 1278 99.2 Plus