BDGP Sequence Production Resources |
Search the DGRC for LD47488
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 474 |
Well: | 88 |
Vector: | pOT2 |
Associated Gene/Transcript | RpS3-RA |
Protein status: | LD47488.pep: gold |
Preliminary Size: | 863 |
Sequenced Size: | 928 |
Gene | Date | Evidence |
---|---|---|
CG6779 | 2002-01-01 | Sim4 clustering to Release 2 |
CG6779 | 2002-05-18 | Blastp of sequenced clone |
CG6779 | 2003-01-01 | Sim4 clustering to Release 3 |
RpS3 | 2008-04-29 | Release 5.5 accounting |
RpS3 | 2008-08-15 | Release 5.9 accounting |
RpS3 | 2008-12-18 | 5.12 accounting |
928 bp (928 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118971
> LD47488.complete GCACACTGGCCTCTTTCTTTTCTGCGCACCACGTTTCCGATTCGACGTCA AAATGAATGCGAACCTTCCGATTTCCAAGAAACGCAAGTTCGTTTCCGAT GGCATCTTCAAGGCTGAATTGAACGAGTTCCTGACTCGCGAACTCGCCGA GGATGGCTACTCCGGCGTGGAGGTCCGTGTGACCCCCTCTCGCACTGAGA TCATCATCATGGCCACCAAGACCCAGCAGGTGCTGGGCGAGAAGGGCCGT CGCATTCGGGAGCTGACCGCCATGGTGCAGAAGCGTTTCAACTTCGAGAC CGGACGCATTGAGTTGTACGCCGAGAAGGTGGCCGCTCGTGGCCTGTGCG CCATTGCCCAGGCTGAGTCGCTGAGGTACAAGCTCACCGGAGGACTGGCC GTCCGTCGTGCTTGCTATGGTGTGCTCCGCTACATCATGGAGTCGGGAGC CAAGGGCTGCGAGGTCGTCGTGTCCGGCAAACTGCGTGGTCAGCGTGCCA AGTCGATGAAATTCGTCGATGGCCTGATGATCCATTCGGGAGATCCGTGC AACGACTATGTCGAGACCGCCACCCGTCATGTGCTCCTCCGCCAGGGAGT GCTTGGTATCAAGGTCAAGGTCATGTTGCCCTACGACCCCAAGAACAAGA TCGGCCCCAAGAAGCCGCTGCCCGACAATGTGTCCGTTGTGGAGCCCAAG GAGGAGAAGATCTACGAGACGCCCGAGACCGAGTACAAGATCCCCCCGCC CAGCAAGCCACTGGACGATCTGTCCGAGGCGAAAGTTTTGTAAACCTAGT TTTACTGTTCATCCAATGAGCGACTAGCTGAAAGAGTTGCCCTCAAATAC AACAAAACAACAGAAACAAAACAAAAACACATAATAATTCAATAAACAAA ATCAATAAGTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS3-RA | 1169 | RpS3-RA | 37..948 | 1..912 | 4560 | 100 | Plus |
RpS3.b | 1150 | RpS3.b | 18..929 | 1..912 | 4560 | 100 | Plus |
RpS3.a | 798 | RpS3.a | 244..797 | 359..912 | 2770 | 100 | Plus |
RpS3.a | 798 | RpS3.a | 18..247 | 1..230 | 1150 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 19182202..19182289 | 1..88 | 100 | -> | Plus |
chr3R | 19182553..19183374 | 89..910 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS3-RA | 1..741 | 53..793 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS3-RA | 1..741 | 53..793 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS3-RA | 1..741 | 53..793 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS3-RA | 1..741 | 53..793 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS3-RA | 1..741 | 53..793 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS3-RA | 1..910 | 1..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS3-RA | 1..910 | 1..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS3-RA | 1..901 | 10..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS3-RA | 1..910 | 1..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS3-RB | 1..901 | 10..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23358803..23358890 | 1..88 | 100 | -> | Plus |
3R | 23359154..23359975 | 89..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23358803..23358890 | 1..88 | 100 | -> | Plus |
3R | 23359154..23359975 | 89..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23358803..23358890 | 1..88 | 100 | -> | Plus |
3R | 23359154..23359975 | 89..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 19184525..19184612 | 1..88 | 100 | -> | Plus |
arm_3R | 19184876..19185697 | 89..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23099985..23100806 | 89..910 | 100 | Plus | |
3R | 23099634..23099721 | 1..88 | 100 | -> | Plus |
Translation from 0 to 792
> LD47488.hyp HTGLFLFCAPRFRFDVKMNANLPISKKRKFVSDGIFKAELNEFLTRELAE DGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFET GRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGA KGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGV LGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPP SKPLDDLSEAKVL*
Translation from 52 to 792
> LD47488.pep MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEI IIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCA IAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAK SMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKI GPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16244-PA | 246 | GF16244-PA | 1..246 | 1..246 | 1274 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11202-PA | 246 | GG11202-PA | 1..246 | 1..246 | 1271 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20000-PA | 246 | GH20000-PA | 1..246 | 1..246 | 1259 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS3-PB | 246 | CG6779-PB | 1..246 | 1..246 | 1252 | 100 | Plus |
RpS3-PA | 246 | CG6779-PA | 1..246 | 1..246 | 1252 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22047-PA | 246 | GI22047-PA | 1..246 | 1..246 | 1266 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13632-PA | 246 | GL13632-PA | 1..246 | 1..246 | 1274 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19858-PA | 246 | GA19858-PA | 1..246 | 1..246 | 1274 | 98.4 | Plus |
Dpse\GA25150-PA | 204 | GA25150-PA | 1..204 | 43..246 | 1054 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26502-PA | 246 | GM26502-PA | 1..246 | 1..246 | 1285 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21014-PA | 246 | GD21014-PA | 1..246 | 1..246 | 1285 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\RpS3-PA | 246 | GJ24100-PA | 1..246 | 1..246 | 1254 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14111-PA | 244 | GK14111-PA | 2..244 | 4..246 | 1252 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpS3-PA | 246 | GE10368-PA | 1..246 | 1..246 | 1278 | 99.2 | Plus |