Clone LD47508 Report

Search the DGRC for LD47508

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:475
Well:8
Vector:pOT2
Associated Gene/TranscriptGILT1-RA
Protein status:LD47508.pep: gold
Preliminary Size:1268
Sequenced Size:1131

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9796 2001-01-01 Release 2 assignment
CG9796 2003-01-01 Sim4 clustering to Release 3
CG9796 2003-03-19 Blastp of sequenced clone
CG9796 2008-04-29 Release 5.5 accounting
CG9796 2008-08-15 Release 5.9 accounting
CG9796 2008-12-18 5.12 accounting

Clone Sequence Records

LD47508.complete Sequence

1131 bp (1131 high quality bases) assembled on 2003-03-19

GenBank Submission: AY061519

> LD47508.complete
CCACCGAACCGCTAACAACACGACCGCCGTTCGTTACGTGCTGGCTATAT
AACTGCATTTATAAGAAATTCTGAAGAACGAGAAGCCTGAAGATGAGTCA
CAAAATCGCCGCTGTGTGCCTCTTGATGAGCTGCCTGATTGCCACGGCTT
ATAGTGCCGCTAAGGTGCCAATTTCTATCTACTACGAGTCCCTGTGCCCG
GACAGCGCCAAGTTCATTACGGAGCAGGTATATCCGGCGGTGAAGGGAGA
ACTGCGCGATGTGGTGGAACTCACTTTCGTGCCATTCGGAAAGTCTCAGT
TCGTTACCCAGGGCTCCGAAGTGACGTTCACCTGCCACCACGGACCGAAC
GAGTGCTATGGCAATAAGGTGCATGCCTGCGCCATCGAGCACATTCAGGC
CAACTCCTATCAGGTGGAGTACACGCGCGAGTCGCTCACGATGGACTTCA
TCAACTGCCTAATGAAGGCCGGCAAGAATTTCCCGGACAACGTCTATCCC
GGCCAGCGATGCGCCTCGGAGAACCACATCAATAACTGGGAGAACATCAA
GACCTGTGCCAACTCCACCGAGGGAAGCGTTCTGCTCCGGAAGGCCGGCG
AAAGCACCATGCGGCTCAAGGAGCCACTCACCAGCGTGCCCACCATTCTG
TTCAATGAGCAATTCGACAAGAAGGTGAATGATCGCGCCCAGGTGAACTT
GGTGGGCACCATCTGCCAATACGTATCCGCCCCGCAGCCGCGCATCTGCA
ACCAGCACAACGGAGCATCGACTCCATCTTTGGCCAGCGTAAGCGCCATC
CTTAGCTCCCTGCTGGGTCTTTGGTTTATCCGCTCCTTCTACTAAGCTAA
GCTAAGCTCAACTGTCCACTCTCTCCGATGTTTCCATTTATATAACTCTT
CCAAGTCAGCTCAAACCTTTGGCAATCGGGAATCTCAACACCTAATGCTG
TATTTTGCTCTTGACCTTTTTGTTGGTTTGTTTTTTAGGCCAATTGAAAC
GCAAGCCGTCCAATTATGCAGCTCGAATATGTGTATCAGAAATTAGTTTT
CAAAGAGCTGATCGTAAAGTAGCAATTTAATAAAGTTGAAATAAAATATG
GTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD47508.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG9796-RA 1182 CG9796-RA 81..1182 1..1102 5510 100 Plus
CG9796.a 982 CG9796.a 81..869 1..789 3945 100 Plus
CG9796.a 982 CG9796.a 869..982 989..1102 570 100 Plus
CG14377-RA 751 CG14377-RA 691..751 1103..1043 305 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9223757..9224201 1102..658 2210 99.8 Minus
chr3R 27901430 chr3R 9224305..9224667 659..297 1755 98.9 Minus
chr3R 27901430 chr3R 9226897..9227063 167..1 820 99.4 Minus
chr3R 27901430 chr3R 9224742..9224878 299..163 685 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:44:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13398525..13398970 1103..658 2230 100 Minus
3R 32079331 3R 13399073..13399435 659..297 1815 100 Minus
3R 32079331 3R 13401676..13401842 167..1 835 100 Minus
3R 32079331 3R 13399510..13399646 299..163 685 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13139356..13139801 1103..658 2230 100 Minus
3R 31820162 3R 13139904..13140266 659..297 1815 100 Minus
3R 31820162 3R 13142507..13142673 167..1 835 100 Minus
3R 31820162 3R 13140341..13140477 299..163 685 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:32:42 has no hits.

LD47508.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:33:37 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9223757..9224199 660..1102 99 <- Minus
chr3R 9224305..9224664 300..659 98 <- Minus
chr3R 9224742..9224876 165..299 100 <- Minus
chr3R 9226900..9227063 1..164 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:31:29 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
CG9796-RA 1..753 93..845 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:46:08 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
CG9796-RA 1..753 93..845 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:13 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
CG9796-RA 1..753 93..845 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:36 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
CG9796-RA 1..753 93..845 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:27:11 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
GILT1-RA 1..753 93..845 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:57:28 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
CG9796-RA 17..1118 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:46:08 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
CG9796-RA 17..1118 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:13 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
CG9796-RA 21..1122 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:36 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
CG9796-RA 17..1118 1..1102 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:27:11 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
GILT1-RA 21..1122 1..1102 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:37 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13398526..13398968 660..1102 100 <- Minus
3R 13399073..13399432 300..659 100 <- Minus
3R 13399510..13399644 165..299 100 <- Minus
3R 13401679..13401842 1..164 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:37 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13398526..13398968 660..1102 100 <- Minus
3R 13399073..13399432 300..659 100 <- Minus
3R 13399510..13399644 165..299 100 <- Minus
3R 13401679..13401842 1..164 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:37 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13398526..13398968 660..1102 100 <- Minus
3R 13399073..13399432 300..659 100 <- Minus
3R 13399510..13399644 165..299 100 <- Minus
3R 13401679..13401842 1..164 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:13 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9224248..9224690 660..1102 100 <- Minus
arm_3R 9224795..9225154 300..659 100 <- Minus
arm_3R 9225232..9225366 165..299 100 <- Minus
arm_3R 9227401..9227564 1..164 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:43 Download gff for LD47508.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13139357..13139799 660..1102 100 <- Minus
3R 13139904..13140263 300..659 100 <- Minus
3R 13140341..13140475 165..299 100 <- Minus
3R 13142510..13142673 1..164 100   Minus

LD47508.pep Sequence

Translation from 92 to 844

> LD47508.pep
MSHKIAAVCLLMSCLIATAYSAAKVPISIYYESLCPDSAKFITEQVYPAV
KGELRDVVELTFVPFGKSQFVTQGSEVTFTCHHGPNECYGNKVHACAIEH
IQANSYQVEYTRESLTMDFINCLMKAGKNFPDNVYPGQRCASENHINNWE
NIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQFDKKVNDRAQ
VNLVGTICQYVSAPQPRICNQHNGASTPSLASVSAILSSLLGLWFIRSFY
*

LD47508.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:44:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17383-PA 251 GF17383-PA 1..251 1..250 1199 86.5 Plus
Dana\GF17838-PA 213 GF17838-PA 34..199 24..211 214 32.4 Plus
Dana\GF16249-PA 207 GF16249-PA 7..192 8..208 213 29 Plus
Dana\GF16248-PA 226 GF16248-PA 40..212 21..209 180 27.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17054-PA 250 GG17054-PA 1..250 1..250 1319 96.8 Plus
Dere\GG17351-PA 209 GG17351-PA 22..192 16..208 222 33.2 Plus
Dere\GG11213-PA 207 GG11213-PA 26..192 21..208 200 27.5 Plus
Dere\GG11212-PA 218 GG11212-PA 32..202 23..209 182 27.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18545-PA 245 GH18545-PA 1..245 1..250 1026 78 Plus
Dgri\GH19011-PA 208 GH19011-PA 29..193 22..208 231 33.7 Plus
Dgri\GH14296-PA 193 GH14296-PA 16..156 24..185 207 31.3 Plus
Dgri\GH18523-PA 204 GH18523-PA 14..190 17..209 199 28.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
GILT1-PA 250 CG9796-PA 1..250 1..250 1320 100 Plus
CG41378-PC 196 CG41378-PC 13..160 24..185 243 34.5 Plus
CG41378-PD 205 CG41378-PD 22..169 24..185 243 34.5 Plus
CG41378-PB 228 CG41378-PB 45..192 24..185 243 34.5 Plus
CG9427-PA 213 CG9427-PA 34..196 24..208 212 33.5 Plus
CG9427-PB 212 CG9427-PB 36..195 27..208 208 33.5 Plus
GILT2-PA 207 CG10157-PA 7..176 8..192 175 27.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23244-PA 245 GI23244-PA 1..244 1..250 1108 78.8 Plus
Dmoj\GI23067-PA 208 GI23067-PA 1..193 1..208 247 32.1 Plus
Dmoj\GI23191-PA 206 GI23191-PA 26..197 21..213 220 30.4 Plus
Dmoj\GI22060-PA 234 GI22060-PA 48..220 21..209 184 25.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23064-PA 250 GL23064-PA 1..250 1..250 1235 88 Plus
Dper\GL22172-PA 217 GL22172-PA 36..203 22..211 234 34.2 Plus
Dper\GL13649-PA 210 GL13649-PA 7..175 8..188 184 29.7 Plus
Dper\GL13648-PA 224 GL13648-PA 1..209 1..208 184 27.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24052-PA 250 GA24052-PA 1..250 1..250 1235 88 Plus
Dpse\GA22042-PA 250 GA22042-PA 1..250 1..250 1235 88 Plus
Dpse\GA21779-PA 217 GA21779-PA 36..203 22..211 234 34.2 Plus
Dpse\GA12550-PA 214 GA12550-PA 1..199 1..208 199 28.3 Plus
Dpse\GA10118-PA 210 GA10118-PA 7..175 8..188 184 29.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25939-PA 250 GM25939-PA 1..250 1..250 1337 98.8 Plus
Dsec\GM26237-PA 213 GM26237-PA 34..196 24..208 217 34.1 Plus
Dsec\GM26511-PA 216 GM26511-PA 29..202 23..211 188 29 Plus
Dsec\GM26512-PA 208 GM26512-PA 8..177 8..192 174 26.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20500-PA 250 GD20500-PA 1..250 1..250 1348 99.6 Plus
Dsim\GD20778-PA 213 GD20778-PA 34..196 24..208 217 34.1 Plus
Dsim\GD21021-PA 208 GD21021-PA 8..180 8..195 186 27.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10741-PA 244 GJ10741-PA 1..244 1..250 1123 80.4 Plus
Dvir\GJ24579-PA 209 GJ24579-PA 1..194 1..208 259 33.8 Plus
Dvir\GJ14507-PA 204 GJ14507-PA 11..182 21..213 216 29.4 Plus
Dvir\GJ24109-PA 230 GJ24109-PA 47..216 24..209 210 29.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13347-PA 232 GK13347-PA 1..230 1..232 1087 84.1 Plus
Dwil\GK11854-PA 217 GK11854-PA 25..216 15..219 242 31.1 Plus
Dwil\GK13875-PA 209 GK13875-PA 32..195 24..208 207 32.6 Plus
Dwil\GK13874-PA 223 GK13874-PA 36..208 21..209 199 29.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24442-PA 250 GE24442-PA 1..250 1..250 1329 97.6 Plus
Dyak\GE24757-PA 213 GE24757-PA 34..196 24..208 221 34.6 Plus
Dyak\GE10377-PA 207 GE10377-PA 29..192 24..208 176 28.5 Plus

LD47508.hyp Sequence

Translation from 92 to 844

> LD47508.hyp
MSHKIAAVCLLMSCLIATAYSAAKVPISIYYESLCPDSAKFITEQVYPAV
KGELRDVVELTFVPFGKSQFVTQGSEVTFTCHHGPNECYGNKVHACAIEH
IQANSYQVEYTRESLTMDFINCLMKAGKNFPDNVYPGQRCASENHINNWE
NIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQFDKKVNDRAQ
VNLVGTICQYVSAPQPRICNQHNGASTPSLASVSAILSSLLGLWFIRSFY
*

LD47508.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
GILT1-PA 250 CG9796-PA 1..250 1..250 1320 100 Plus
CG41378-PC 196 CG41378-PC 13..160 24..185 243 34.5 Plus
CG41378-PD 205 CG41378-PD 22..169 24..185 243 34.5 Plus
CG41378-PB 228 CG41378-PB 45..192 24..185 243 34.5 Plus
CG9427-PA 213 CG9427-PA 34..196 24..208 212 33.5 Plus