Clone LD47606 Report

Search the DGRC for LD47606

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:476
Well:6
Vector:pOT2
Associated Gene/TranscriptCG43780-RA
Protein status:LD47606.pep: gold
Preliminary Size:1518
Sequenced Size:1412

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8600 2001-01-01 Release 2 assignment
CG8600 2001-07-04 Blastp of sequenced clone
CG8600 2003-01-01 Sim4 clustering to Release 3
CG8600 2008-04-29 Release 5.5 accounting
CG8600 2008-08-15 Release 5.9 accounting
CG8600 2008-12-18 5.12 accounting

Clone Sequence Records

LD47606.complete Sequence

1412 bp (1412 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060444

> LD47606.complete
TTTTCGTAGCAGCAAAGTGGCTGAAATTAATAACATTTAAGAGCAGAAGT
GTGTAACACACCTGAATGGGACTTGTGCCAATCTCAGTGACCACCAATCG
CGCGCAAATGACCATTGAGCATTGTGCAGCAGGCTATTGAGGCTCTTGCA
AGTGACCACACCCCTATAAGACTATGTCCACAATCGAAGAGGAACGCAAG
GCGTACGAAAAGAATCCCTACTTCACCGGCCACATCTACGGCAACTTCTC
GCCGTTTTATGTGACCATTGCCATCTGCACGGTTGTCCTGGGCACGATCA
TAATACTGAACATTATCTTGGGCTGCTGCTCCAAGCATCGCAAGTACTGG
CAGGACAGGCACACGGGCAATCGCTGGTTGGTTTCCATTTGGTCTGCCAC
GCCCCACAATCAGCCGCCATTGGATTTCACTGAGCTGAAGGACGCCTCAT
ACTTTCAGCGCTTCCATCCCACAACCCATCAGCAAGTGTTCCCCGACGAC
GTTGTCATCGGCGTTGACGACTTGGAGCCCGTGCACTCGGCGCACCATCA
TCATCACCAGCAGCAGCACCAGCGTCCACCACGTCCAGAGGGTCGCACTT
TGCACCAGCAGCGCCAGCGCGAGGAATACGTGGAGTTGCAGAAGCGCGAG
AGCGACATCTAAGTAGCAATGGCTCTTTACTTCCTTTATCCCGCCGTGGC
CGCCGTCGCCCTGTTCATCGTGGGCGTTATCATTGTCATGCTGCGCTACG
GACCGCGTTTGTGCGGTTTGCGCCACCATGCGCTTCCCGATGACGAGGAT
CTGCGGGGAAAGACGTATGAGCATGAGATTAGCTATGCCTAATATTGGGG
TGTTCAGGGGTGTCCCATTAATCCCATTCAACCAATGGGTATTGTTGGTG
ATTTCTTGGACAGCCCTGCCTTTAATTTACATACTTATACATGCCGGCAA
TGCTACGAATTGCTTCTTATATATCTCTCTCCCCCCAAAACTAATCCTAG
CTACTGTAAGAGCCCACTAACCCGTCTGCACCCACCAACCATATCAGTTT
TGCATGCAGTACAAATAGTTTCATTAGCAACCAGTTTTGTTCGAGCCGAT
TCCATTCCATTAATCGCAATCTGACAATGTGCCTTTCACGTAGAGACTCG
TAAGAAATTTATACCGTCCAAGTGTCTTTTCTAGCGCCGTAAGATCGAAT
TGTATTTTTACATTTAATACCCATTTAGGGTAGTCTGTCTACAGATGCTG
CATTTAATGTTGTCCAATATTCTACTCGTATGAAAATATCAGTGTCTTGT
ATCTACTACAAACTCTATACATTTGTATTCGTCCATTAGTTTTGTAATAT
TGTATTTTGAAGTTGCATCAAATAAATCTACGGCCCCCAAAATAAAAAAA
AAAAAAAAAAAA

LD47606.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG8600-RA 1581 CG8600-RA 141..1535 1..1395 6975 100 Plus
CG8600.a 1438 CG8600.a 522..1434 483..1395 4565 100 Plus
CG8600.a 1438 CG8600.a 55..522 1..468 2340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7325678..7326602 1393..468 4445 98.9 Minus
chr3L 24539361 chr3L 7326675..7327032 467..110 1790 100 Minus
chr3L 24539361 chr3L 7327213..7327322 110..1 550 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:44:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7333542..7334469 1395..468 4640 100 Minus
3L 28110227 3L 7334542..7334899 467..110 1790 100 Minus
3L 28110227 3L 7335080..7335189 110..1 550 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7326642..7327569 1395..468 4640 100 Minus
3L 28103327 3L 7327642..7327999 467..110 1790 100 Minus
3L 28103327 3L 7328180..7328289 110..1 550 100 Minus
Blast to na_te.dros performed 2019-03-16 11:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6781..6902 542..662 139 58.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6739..6875 542..673 131 59.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1541..1578 542..579 118 78.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6760..6875 542..659 117 59.2 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3262..3324 526..588 117 65.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2477..2531 537..588 114 72.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6849 544..668 114 58.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2433..2511 535..612 113 62 Plus

LD47606.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:30:16 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7325678..7326602 468..1393 98 <- Minus
chr3L 7326675..7327031 111..467 100 <- Minus
chr3L 7327213..7327322 1..110 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:31:48 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
CG8600-RB 1..669 174..842 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:14:39 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
CG8600-RB 1..669 174..842 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:53:16 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
CG43780-RA 1..489 174..662 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:45:59 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
CG8600-RA 1..489 174..662 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:18:13 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
CG43780-RA 1..489 174..662 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:07:54 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
CG8600-RB 55..1447 1..1393 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:14:39 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
CG8600-RB 55..1447 1..1393 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:53:16 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
CG43781-RA 38..1430 1..1393 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:45:59 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
CG8600-RA 36..1428 1..1393 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:18:13 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
CG43780-RA 38..1430 1..1393 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:30:16 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7333544..7334469 468..1393 100 <- Minus
3L 7334542..7334898 111..467 100 <- Minus
3L 7335080..7335189 1..110 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:30:16 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7333544..7334469 468..1393 100 <- Minus
3L 7334542..7334898 111..467 100 <- Minus
3L 7335080..7335189 1..110 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:30:16 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7333544..7334469 468..1393 100 <- Minus
3L 7334542..7334898 111..467 100 <- Minus
3L 7335080..7335189 1..110 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:53:16 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7326644..7327569 468..1393 100 <- Minus
arm_3L 7327642..7327998 111..467 100 <- Minus
arm_3L 7328180..7328289 1..110 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:23:51 Download gff for LD47606.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7326644..7327569 468..1393 100 <- Minus
3L 7327642..7327998 111..467 100 <- Minus
3L 7328180..7328289 1..110 100   Minus

LD47606.hyp Sequence

Translation from 173 to 661

> LD47606.hyp
MSTIEEERKAYEKNPYFTGHIYGNFSPFYVTIAICTVVLGTIIILNIILG
CCSKHRKYWQDRHTGNRWLVSIWSATPHNQPPLDFTELKDASYFQRFHPT
THQQVFPDDVVIGVDDLEPVHSAHHHHHQQQHQRPPRPEGRTLHQQRQRE
EYVELQKRESDI*

LD47606.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG43780-PA 162 CG43780-PA 1..162 1..162 901 100 Plus
CG43780-PB 157 CG43780-PB 1..157 1..162 855 96.9 Plus

LD47606.pep Sequence

Translation from 173 to 661

> LD47606.pep
MSTIEEERKAYEKNPYFTGHIYGNFSPFYVTIAICTVVLGTIIILNIILG
CCSKHRKYWQDRHTGNRWLVSIWSATPHNQPPLDFTELKDASYFQRFHPT
THQQVFPDDVVIGVDDLEPVHSAHHHHHQQQHQRPPRPEGRTLHQQRQRE
EYVELQKRESDI*

LD47606.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23858-PA 153 GF23858-PA 1..153 1..162 793 92.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14978-PA 161 GG14978-PA 1..161 1..162 852 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16095-PA 155 GH16095-PA 1..155 1..162 677 84.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG43780-PA 162 CG43780-PA 1..162 1..162 901 100 Plus
CG43780-PB 157 CG43780-PB 1..157 1..162 855 96.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12358-PA 156 GI12358-PA 1..156 1..162 747 86.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21151-PA 155 GL21151-PA 1..155 1..162 801 93.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21196-PA 155 GA21196-PA 1..155 1..162 801 93.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13774-PA 162 GM13774-PA 1..162 1..162 868 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13072-PA 162 GD13072-PA 1..162 1..162 872 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12251-PA 155 GJ12251-PA 1..155 1..162 749 86.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16670-PA 162 GK16670-PA 1..162 1..162 776 88 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20425-PA 161 GE20425-PA 1..161 1..162 855 99.4 Plus