Clone LD47919 Report

Search the DGRC for LD47919

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:479
Well:19
Vector:pOT2
Associated Gene/Transcriptmtrm-RA
Protein status:LD47919.pep: gold
Preliminary Size:1179
Sequenced Size:1065

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18543 2001-01-01 Release 2 assignment
CG7127 2001-01-01 Release 2 assignment
CG18543 2003-01-01 Sim4 clustering to Release 3
CG18543 2003-01-14 Blastp of sequenced clone
mtrm 2008-04-29 Release 5.5 accounting
mtrm 2008-08-15 Release 5.9 accounting
mtrm 2008-12-18 5.12 accounting

Clone Sequence Records

LD47919.complete Sequence

1065 bp (1065 high quality bases) assembled on 2003-01-14

GenBank Submission: AY061524

> LD47919.complete
TCACAGTATCTAAAAAAAATGGAGAATTCTCGCACGCCCACGAACAAGAC
CAAAATTACGCTTAATCGCACGCCAACGCTAAAGGAGCGCAGATGGAACA
CCCTGAAGGTGAACACCTCCAACGTGCGATGCTCTACTCCGATCTTTGGC
AACTTCCGTTCGCCCAATCTCTCGCCCATCGAGAATATGGGCACGAAGGG
GAAGAGTCCAGTGTCGCCCATGCGGTTCGCTACCTTCAAGAAAGTGCCAA
CGAAGGTGCATCCCAAGCAGCAGCAGCAGCAGCAGCATCAGCACTGCCAT
CGCACTCAGCTTAAGCCCCCGCCATTCGTGCTGCCCAAGCCGCAGGAGGA
GATCATCGAGCCGGAGCGAGAAATAAAGAGCTGCAGCAGCCCGGATACCT
GTTCGGATGACTCGAATATGGAGACCTCACTGGCCTTGGAGTCGCGTCGT
CGTTCCATCAAAGCATCGAACCACTCGTACGTGGTTAACCATGCCGCCAA
TGTGGAACAGATTCTCATGCACATGGGCCTGGAGAACTATGTGACCAATT
TCGAAGAGGCTCACATCGATCTGGTGGAACTGGCATCCTTGGAGCGTGCT
GATCTTGTTAAAATCGGCCTAAATACCGATGAGGATTGCAACCGTATCAT
GGATGTGCTCCACACTCTTTAAGTGAATCGCTGGCATGTCCATCTTTTAT
CATACACTAAGATTTTAAAATGTTTTATGTGAAGAGAAACTTTGTGATTT
TAATATATGTGGATAATTAAGTAGGTATTCTAGAATTATTGTAAAAGACC
TGGTGTCTTAAAGCTCGTCGTTTTTAGCCTTAAATAATAAACTCTAGTAC
ACTTTAAGAATCTATGTAATTCCTAAAATGTTGCTCCGAAGCTCATTTAC
AAATTTAAATTTATTTCGTAAGCTAGCAAATTGCATAATACTTTTTGTCA
AAAAAAAAAAAAAAAATTGGGGTATAAACGCTTTTGTAAAACACACATTT
TTAAAATTAATAAACTCATAAGAATCAAATGCATATTAAAAGGTTACAAA
AAAAAAAAAAAAAAA

LD47919.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
mtrm-RA 1089 mtrm-RA 43..1089 1..1047 5235 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8405062..8406100 1..1047 4975 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:45:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8413057..8414108 1..1052 5260 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8406157..8407208 1..1052 5260 100 Plus
Blast to na_te.dros performed 2019-03-15 22:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy12 10218 gypsy12 GYPSY12 10218bp 1885..1947 1041..980 123 68.3 Minus
gypsy12 10218 gypsy12 GYPSY12 10218bp 9767..9829 1041..980 123 68.3 Minus

LD47919.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:33:40 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8405062..8406100 1..1047 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:32:20 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
mtrm-RA 1..654 19..672 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:54 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
mtrm-RA 1..654 19..672 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:17 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
mtrm-RA 1..654 19..672 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:45 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
mtrm-RA 1..654 19..672 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:27:17 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
mtrm-RA 1..654 19..672 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:12:48 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
mtrm-RA 43..1089 1..1047 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:54 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
mtrm-RA 43..1089 1..1047 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:17 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
mtrm-RA 46..1092 1..1047 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:45 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
mtrm-RA 43..1089 1..1047 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:27:17 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
mtrm-RA 46..1092 1..1047 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:40 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8413057..8414103 1..1047 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:40 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8413057..8414103 1..1047 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:40 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8413057..8414103 1..1047 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:17 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8406157..8407203 1..1047 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:19:04 Download gff for LD47919.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8406157..8407203 1..1047 100   Plus

LD47919.hyp Sequence

Translation from 0 to 671

> LD47919.hyp
SQYLKKMENSRTPTNKTKITLNRTPTLKERRWNTLKVNTSNVRCSTPIFG
NFRSPNLSPIENMGTKGKSPVSPMRFATFKKVPTKVHPKQQQQQQHQHCH
RTQLKPPPFVLPKPQEEIIEPEREIKSCSSPDTCSDDSNMETSLALESRR
RSIKASNHSYVVNHAANVEQILMHMGLENYVTNFEEAHIDLVELASLERA
DLVKIGLNTDEDCNRIMDVLHTL*

LD47919.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
mtrm-PA 217 CG18543-PA 1..217 7..223 1143 100 Plus

LD47919.pep Sequence

Translation from 18 to 671

> LD47919.pep
MENSRTPTNKTKITLNRTPTLKERRWNTLKVNTSNVRCSTPIFGNFRSPN
LSPIENMGTKGKSPVSPMRFATFKKVPTKVHPKQQQQQQHQHCHRTQLKP
PPFVLPKPQEEIIEPEREIKSCSSPDTCSDDSNMETSLALESRRRSIKAS
NHSYVVNHAANVEQILMHMGLENYVTNFEEAHIDLVELASLERADLVKIG
LNTDEDCNRIMDVLHTL*

LD47919.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
mtrm-PA 217 CG18543-PA 1..217 1..217 1143 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24705-PA 203 GL24705-PA 1..203 1..217 528 58.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23958-PA 890 GA23958-PA 246..439 5..212 520 59.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25054-PA 906 GM25054-PA 247..455 1..212 1016 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19117-PA 188 GJ19117-PA 1..185 1..214 401 42.1 Plus
Dvir\GJ12974-PA 861 GJ12974-PA 253..410 27..200 320 45.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15529-PA 186 GK15529-PA 14..179 7..199 353 45.6 Plus