Clone LD48010 Report

Search the DGRC for LD48010

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:480
Well:10
Vector:pOT2
Associated Gene/TranscriptGstZ1-RA
Protein status:LD48010.pep: gold
Preliminary Size:1046
Sequenced Size:906

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9362 2001-01-01 Release 2 assignment
CG9362 2003-01-01 Sim4 clustering to Release 3
CG9362 2003-05-21 Blastp of sequenced clone
CG9362 2008-04-29 Release 5.5 accounting
CG9362 2008-08-15 Release 5.9 accounting
CG9362 2008-12-18 5.12 accounting

Clone Sequence Records

LD48010.complete Sequence

906 bp (906 high quality bases) assembled on 2003-05-21

GenBank Submission: AY061527

> LD48010.complete
TAAACCGGTTGTTTTTCTCACTATAAGTTCTGTTACTTAATAGAAGGGTT
CTCTTAAAGAATATATATTTACATATATGGCTTCTGCTACCCAATTGACC
CACAGAGGTATCCATTTGGCCGGACTGTACAGATCTTCTTGGTCTAAGCC
CTTGTTCCGACATTTGGCAACAAAGCCTATACTGTATTCCTATTGGCCTA
GTTCGTGTTCTTGGAGAGTTCGCGTTGCGCTGGCAATAAAGAAGATTGAT
TATGACATTAAGCCGACTTCTTTGCTAAAAACAGTTAGCGGACATGCCTA
TACGGATGAATATAGGGAAGTCAATCCGATGCAAAAGGTTCCCTCGTTGA
AGATTGATGGCCATACCTTGTGCGACTCGGTGGCTATTATCCACTACCTG
GAGGAAACTCGACCTCAGCCAGCACTTCTGCCCCAAGATCCGGTTAAAAG
AGCAAAGATCCGTGAAATTGTGGAGCTCATTTGCTCGGGCATCCAGCCAC
TGCAAAATGTATCTGTCCTAGATCATATAGGCAAGGATCAGAGTCTGCAA
TGGGCACAACACTGGATTTCTCGAGGATTTCAGGGTCTCGAAAAGGTTCT
TTCCCATTCGGCGGGCAAATTCTGTGTGGGAGATGAGCTCAGCATGGCTG
ATATTTGCCTGGTACCTCAGGTGCGCAATGCCAGGAGATACAAAGCTGAC
CTGACCCCATATCCCACCATAGTACGCTTGAATCAGGAACTACAAGAACT
TGATGTCTTCAAAGCCACTCATCCCAGTACCCAGCCAGATTGTCCACCTG
AATTCGCAAAAAAATAATCAAAACTTAAGATATATTACATTGCATTTATA
AAGATGCTTGATATTAAATGGATTTCCAAAGCACCCAGAAAAAAAAAAAA
AAAAAA

LD48010.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG9362-RA 968 CG9362-RA 58..945 1..888 4440 100 Plus
ps.g 1733 ps.g 1663..1733 799..729 355 100 Minus
ps.f 2641 ps.f 2571..2641 799..729 355 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5282011..5282366 356..1 1735 99.2 Minus
chr3R 27901430 chr3R 5281626..5281957 687..356 1645 99.7 Minus
chr3R 27901430 chr3R 5281362..5281564 888..686 1000 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:45:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9456166..9456521 356..1 1780 100 Minus
3R 32079331 3R 9455781..9456112 687..356 1660 100 Minus
3R 32079331 3R 9455517..9455719 888..686 1015 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9196997..9197352 356..1 1780 100 Minus
3R 31820162 3R 9196612..9196943 687..356 1660 100 Minus
3R 31820162 3R 9196348..9196550 888..686 1015 100 Minus
3R 31820162 3R 9199039..9199170 682..551 165 75 Minus
Blast to na_te.dros performed on 2019-03-16 01:54:15 has no hits.

LD48010.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:54:54 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5281362..5281562 688..888 99 <- Minus
chr3R 5281626..5281956 357..687 99 <- Minus
chr3R 5282011..5282366 1..356 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:32:34 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
CG9362-RA 1..741 77..817 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:05:02 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
CG9362-RA 1..741 77..817 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:21 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
GstZ1-RA 1..741 77..817 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:35:45 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
CG9362-RA 1..741 77..817 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:50:39 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
GstZ1-RA 1..741 77..817 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:54:22 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
CG9362-RA 22..909 1..888 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:05:02 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
CG9362-RA 22..909 1..888 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:21 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
GstZ1-RA 26..913 1..888 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:35:45 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
CG9362-RA 22..909 1..888 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:50:39 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
GstZ1-RA 26..913 1..888 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:54 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9455517..9455717 688..888 100 <- Minus
3R 9455781..9456111 357..687 100 <- Minus
3R 9456166..9456521 1..356 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:54 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9455517..9455717 688..888 100 <- Minus
3R 9455781..9456111 357..687 100 <- Minus
3R 9456166..9456521 1..356 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:54 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9455517..9455717 688..888 100 <- Minus
3R 9455781..9456111 357..687 100 <- Minus
3R 9456166..9456521 1..356 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:21 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5281239..5281439 688..888 100 <- Minus
arm_3R 5281503..5281833 357..687 100 <- Minus
arm_3R 5281888..5282243 1..356 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:12:44 Download gff for LD48010.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9196348..9196548 688..888 100 <- Minus
3R 9196612..9196942 357..687 100 <- Minus
3R 9196997..9197352 1..356 100   Minus

LD48010.pep Sequence

Translation from 76 to 816

> LD48010.pep
MASATQLTHRGIHLAGLYRSSWSKPLFRHLATKPILYSYWPSSCSWRVRV
ALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCD
SVAIIHYLEETRPQPALLPQDPVKRAKIREIVELICSGIQPLQNVSVLDH
IGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVR
NARRYKADLTPYPTIVRLNQELQELDVFKATHPSTQPDCPPEFAKK*

LD48010.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17763-PA 250 GF17763-PA 1..249 1..246 888 65.5 Plus
Dana\GF17762-PA 220 GF17762-PA 7..220 32..246 799 67 Plus
Dana\GF12161-PA 223 GF12161-PA 7..195 35..220 154 32.3 Plus
Dana\GF12160-PA 223 GF12160-PA 7..206 35..235 148 28.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17372-PA 246 GG17372-PA 1..246 1..246 1220 91.5 Plus
Dere\GG17371-PA 220 GG17371-PA 7..220 32..246 799 67 Plus
Dere\GG21881-PA 223 GG21881-PA 7..203 35..232 158 31.5 Plus
Dere\GG21880-PA 224 GG21880-PA 7..200 35..229 149 31 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19138-PA 220 GH19138-PA 7..220 32..246 797 66.5 Plus
Dgri\GH19140-PA 247 GH19140-PA 27..242 32..246 755 62.5 Plus
Dgri\GH19139-PA 218 GH19139-PA 17..214 32..238 686 63.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
GstZ1-PA 246 CG9362-PA 1..246 1..246 1305 100 Plus
GstZ2-PB 220 CG9363-PB 8..220 33..246 794 67.3 Plus
GstZ2-PA 227 CG9363-PA 15..227 33..246 790 66.8 Plus
GstZ2-PC 215 CG9363-PC 4..215 34..246 789 67.1 Plus
GstE6-PA 222 CG17530-PA 3..199 33..229 151 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23597-PA 246 GI23597-PA 32..246 32..246 804 65.6 Plus
Dmoj\GI23596-PA 220 GI23596-PA 7..220 32..246 797 66.5 Plus
Dmoj\GI20133-PA 225 GI20133-PA 5..207 30..232 152 25.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13669-PA 256 GL13669-PA 43..256 33..246 865 72.4 Plus
Dper\GL13668-PA 240 GL13668-PA 7..240 32..246 770 61.3 Plus
Dper\GL17768-PA 222 GL17768-PA 6..199 35..229 157 31.5 Plus
Dper\GL17783-PA 226 GL17783-PA 1..203 30..232 149 24.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21731-PA 231 GA21731-PA 18..231 33..246 863 72.4 Plus
Dpse\GA21732-PA 220 GA21732-PA 7..220 32..246 799 67 Plus
Dpse\GA18702-PA 222 GA18702-PA 6..199 35..229 152 31 Plus
Dpse\GA18748-PA 226 GA18748-PA 1..200 30..229 147 25.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26257-PA 246 GM26257-PA 1..246 1..246 1259 94.7 Plus
Dsec\GM26256-PA 220 GM26256-PA 7..220 32..246 799 67 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20796-PA 246 GD20796-PA 1..246 1..246 1276 95.9 Plus
Dsim\GD20795-PA 220 GD20795-PA 7..220 32..246 799 67 Plus
Dsim\GD11370-PA 224 GD11370-PA 7..200 35..229 144 30.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23570-PA 220 GJ23570-PA 7..220 32..246 797 66.5 Plus
Dvir\GJ23571-PA 162 GJ23571-PA 1..162 85..246 626 70.4 Plus
Dvir\GJ19903-PA 228 GJ19903-PA 9..208 33..232 161 27.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12126-PA 220 GK12126-PA 7..220 32..246 799 67 Plus
Dwil\GK12127-PA 246 GK12127-PA 34..243 33..242 744 62.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24777-PA 246 GE24777-PA 1..246 1..246 1165 86.2 Plus
Dyak\GE24775-PA 220 GE24775-PA 7..220 32..246 799 67 Plus

LD48010.hyp Sequence

Translation from 76 to 816

> LD48010.hyp
MASATQLTHRGIHLAGLYRSSWSKPLFRHLATKPILYSYWPSSCSWRVRV
ALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCD
SVAIIHYLEETRPQPALLPQDPVKRAKIREIVELICSGIQPLQNVSVLDH
IGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVR
NARRYKADLTPYPTIVRLNQELQELDVFKATHPSTQPDCPPEFAKK*

LD48010.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
GstZ1-PA 246 CG9362-PA 1..246 1..246 1305 100 Plus
GstZ2-PB 220 CG9363-PB 8..220 33..246 794 67.3 Plus
GstZ2-PA 227 CG9363-PA 15..227 33..246 790 66.8 Plus
GstZ2-PC 215 CG9363-PC 4..215 34..246 789 67.1 Plus
GstE6-PA 222 CG17530-PA 3..199 33..229 151 29.4 Plus