Clone LP01012 Report

Search the DGRC for LP01012

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:10
Well:12
Vector:pOT2
Associated Gene/TranscriptCG8750-RA
Protein status:LP01012.pep: gold
Sequenced Size:399

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8750 2003-01-01 Sim4 clustering to Release 3
CG8750 2004-01-31 Blastp of sequenced clone
CG8750 2008-04-29 Release 5.5 accounting
CG8750 2008-08-15 Release 5.9 accounting
CG8750 2008-12-18 5.12 accounting

Clone Sequence Records

LP01012.complete Sequence

399 bp (399 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011544

> LP01012.complete
TTTAAAATCATTCGAACTGATAGAGCCATTTGGAGCGAGTGAATGCGAAC
CAAATTATGCTTAAGATTCCAAATCGGCGCAAGATGCCTGTGTCAGAGCA
ACAGCCTCGAGTCATCAAGATAGAGCGACCAACGACTGGAAGGATACTAG
GTCCTTTGAACGTGGCCAGCATGCAGCAGCAGAACTTCTTGGCCAAGAAC
AACCCAAAAATATCCGAAGATCTGGGCAGTCGCTTGCAGACTCTGCAGAG
ACGTGTCCAAGAGTGGAAGTCTTCAGGCCAAGTCTGAGATAAAACGTAAA
CTTGGGGATGATGCAAAAATAAATATTGAACAAATCGAAGTAACTTAACT
TAACCAAATAAACAAATAGTTAAAGCATAATAAAAAAAAAAAAAAAAAA

LP01012.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG8750-RA 449 CG8750-RA 72..449 1..378 1890 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13832745..13833125 381..1 1905 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:45:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13842565..13842946 382..1 1910 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13835665..13836046 382..1 1910 100 Minus
Blast to na_te.dros performed 2019-03-15 22:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 174..218 352..308 117 73.3 Minus
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 6502..6546 352..308 117 73.3 Minus

LP01012.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:33:42 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13832745..13833125 1..381 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:32:42 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 1..231 57..287 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:40 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 1..231 57..287 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:21 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 1..231 57..287 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:30 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 1..231 57..287 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:27:20 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 1..231 57..287 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:43 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 72..430 1..359 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:40 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 72..430 1..359 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:21 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 72..452 1..381 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:31 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 72..430 1..359 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:27:20 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 72..452 1..381 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:42 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13842566..13842946 1..381 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:42 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13842566..13842946 1..381 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:42 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13842566..13842946 1..381 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:21 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13835666..13836046 1..381 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:55 Download gff for LP01012.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13835666..13836046 1..381 100   Minus

LP01012.hyp Sequence

Translation from 56 to 286

> LP01012.hyp
MLKIPNRRKMPVSEQQPRVIKIERPTTGRILGPLNVASMQQQNFLAKNNP
KISEDLGSRLQTLQRRVQEWKSSGQV*

LP01012.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8750-PB 76 CG8750-PB 1..76 1..76 384 100 Plus
CG8750-PA 76 CG8750-PA 1..76 1..76 384 100 Plus

LP01012.pep Sequence

Translation from 56 to 286

> LP01012.pep
MLKIPNRRKMPVSEQQPRVIKIERPTTGRILGPLNVASMQQQNFLAKNNP
KISEDLGSRLQTLQRRVQEWKSSGQV*

LP01012.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13755-PA 76 GG13755-PA 1..76 1..76 347 89.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG8750-PB 76 CG8750-PB 1..76 1..76 384 100 Plus
CG8750-PA 76 CG8750-PA 1..76 1..76 384 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24578-PA 67 GM24578-PA 1..67 10..76 299 86.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17079-PA 78 GK17079-PA 1..74 1..72 138 43.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20051-PA 76 GE20051-PA 1..76 1..76 314 81.6 Plus