LP01012.complete Sequence
399 bp (399 high quality bases) assembled on 2004-01-31
GenBank Submission: BT011544
> LP01012.complete
TTTAAAATCATTCGAACTGATAGAGCCATTTGGAGCGAGTGAATGCGAAC
CAAATTATGCTTAAGATTCCAAATCGGCGCAAGATGCCTGTGTCAGAGCA
ACAGCCTCGAGTCATCAAGATAGAGCGACCAACGACTGGAAGGATACTAG
GTCCTTTGAACGTGGCCAGCATGCAGCAGCAGAACTTCTTGGCCAAGAAC
AACCCAAAAATATCCGAAGATCTGGGCAGTCGCTTGCAGACTCTGCAGAG
ACGTGTCCAAGAGTGGAAGTCTTCAGGCCAAGTCTGAGATAAAACGTAAA
CTTGGGGATGATGCAAAAATAAATATTGAACAAATCGAAGTAACTTAACT
TAACCAAATAAACAAATAGTTAAAGCATAATAAAAAAAAAAAAAAAAAA
LP01012.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:05:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8750-RA | 449 | CG8750-RA | 72..449 | 1..378 | 1890 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:32:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 13832745..13833125 | 381..1 | 1905 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:45:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:32:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13842565..13842946 | 382..1 | 1910 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 13835665..13836046 | 382..1 | 1910 | 100 | Minus |
Blast to na_te.dros performed 2019-03-15 22:32:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\ninja | 6644 | Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). | 174..218 | 352..308 | 117 | 73.3 | Minus |
Dsim\ninja | 6644 | Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). | 6502..6546 | 352..308 | 117 | 73.3 | Minus |
LP01012.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:33:42 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 13832745..13833125 | 1..381 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:32:42 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8750-RA | 1..231 | 57..287 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:40 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8750-RA | 1..231 | 57..287 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:21 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8750-RA | 1..231 | 57..287 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:30 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8750-RA | 1..231 | 57..287 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:27:20 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8750-RA | 1..231 | 57..287 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:43 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8750-RA | 72..430 | 1..359 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:40 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8750-RA | 72..430 | 1..359 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:21 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8750-RA | 72..452 | 1..381 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:31 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8750-RA | 72..430 | 1..359 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:27:20 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8750-RA | 72..452 | 1..381 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:42 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13842566..13842946 | 1..381 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:42 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13842566..13842946 | 1..381 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:33:42 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13842566..13842946 | 1..381 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:21 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13835666..13836046 | 1..381 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:55 Download gff for
LP01012.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13835666..13836046 | 1..381 | 100 | | Minus |
LP01012.hyp Sequence
Translation from 56 to 286
> LP01012.hyp
MLKIPNRRKMPVSEQQPRVIKIERPTTGRILGPLNVASMQQQNFLAKNNP
KISEDLGSRLQTLQRRVQEWKSSGQV*
LP01012.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8750-PB | 76 | CG8750-PB | 1..76 | 1..76 | 384 | 100 | Plus |
CG8750-PA | 76 | CG8750-PA | 1..76 | 1..76 | 384 | 100 | Plus |
LP01012.pep Sequence
Translation from 56 to 286
> LP01012.pep
MLKIPNRRKMPVSEQQPRVIKIERPTTGRILGPLNVASMQQQNFLAKNNP
KISEDLGSRLQTLQRRVQEWKSSGQV*
LP01012.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:35:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13755-PA | 76 | GG13755-PA | 1..76 | 1..76 | 347 | 89.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8750-PB | 76 | CG8750-PB | 1..76 | 1..76 | 384 | 100 | Plus |
CG8750-PA | 76 | CG8750-PA | 1..76 | 1..76 | 384 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:35:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24578-PA | 67 | GM24578-PA | 1..67 | 10..76 | 299 | 86.6 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:35:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK17079-PA | 78 | GK17079-PA | 1..74 | 1..72 | 138 | 43.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:35:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20051-PA | 76 | GE20051-PA | 1..76 | 1..76 | 314 | 81.6 | Plus |